NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F066518

Metagenome Family F066518

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066518
Family Type Metagenome
Number of Sequences 126
Average Sequence Length 56 residues
Representative Sequence MFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Number of Associated Samples 110
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.20 %
% of genes near scaffold ends (potentially truncated) 34.92 %
% of genes from short scaffolds (< 2000 bps) 84.92 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.016 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.206 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 51.79%    β-sheet: 0.00%    Coil/Unstructured: 48.21%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF00990GGDEF 48.41
PF01546Peptidase_M20 8.73
PF03706LPG_synthase_TM 1.59
PF00535Glycos_transf_2 0.79
PF12697Abhydrolase_6 0.79
PF02146SIR2 0.79
PF01266DAO 0.79
PF12706Lactamase_B_2 0.79
PF03473MOSC 0.79
PF01433Peptidase_M1 0.79
PF09335SNARE_assoc 0.79
PF00589Phage_integrase 0.79
PF09118GO-like_E_set 0.79
PF12840HTH_20 0.79
PF01416PseudoU_synth_1 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 1.59
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 0.79
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.79
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.79
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.79
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.79
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.89 %
UnclassifiedrootN/A11.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig106887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105152856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium533Open in IMG/M
3300000550|F24TB_10055917Not Available821Open in IMG/M
3300000953|JGI11615J12901_10093316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium577Open in IMG/M
3300000956|JGI10216J12902_100272870All Organisms → cellular organisms → Bacteria1948Open in IMG/M
3300000956|JGI10216J12902_106015485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
3300002568|C688J35102_119506447Not Available708Open in IMG/M
3300003203|JGI25406J46586_10067835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1128Open in IMG/M
3300003267|soilL1_10021852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7241Open in IMG/M
3300003987|Ga0055471_10232069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium582Open in IMG/M
3300004081|Ga0063454_100169432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1190Open in IMG/M
3300004114|Ga0062593_100060697All Organisms → cellular organisms → Bacteria2431Open in IMG/M
3300004114|Ga0062593_100700691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium988Open in IMG/M
3300004114|Ga0062593_101511821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300004114|Ga0062593_102773872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium559Open in IMG/M
3300004114|Ga0062593_103566872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium500Open in IMG/M
3300004157|Ga0062590_100950540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300004157|Ga0062590_101228776All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300004157|Ga0062590_102882890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium514Open in IMG/M
3300004463|Ga0063356_100901708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1249Open in IMG/M
3300004479|Ga0062595_100753939Not Available793Open in IMG/M
3300004479|Ga0062595_101726400All Organisms → cellular organisms → Bacteria → Terrabacteria group591Open in IMG/M
3300005172|Ga0066683_10175100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1322Open in IMG/M
3300005329|Ga0070683_100175568Not Available2034Open in IMG/M
3300005336|Ga0070680_100772366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium828Open in IMG/M
3300005337|Ga0070682_101692796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium549Open in IMG/M
3300005356|Ga0070674_100754211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium837Open in IMG/M
3300005536|Ga0070697_100950596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300005536|Ga0070697_101568520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300005544|Ga0070686_101579294All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300005546|Ga0070696_100180380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1566Open in IMG/M
3300005547|Ga0070693_100316455All Organisms → cellular organisms → Bacteria → Terrabacteria group1057Open in IMG/M
3300005577|Ga0068857_100983733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300005616|Ga0068852_102108583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium586Open in IMG/M
3300005618|Ga0068864_100866235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium891Open in IMG/M
3300005713|Ga0066905_100256347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1347Open in IMG/M
3300005873|Ga0075287_1052989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium560Open in IMG/M
3300005937|Ga0081455_10024021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5655Open in IMG/M
3300006058|Ga0075432_10373191Not Available610Open in IMG/M
3300006876|Ga0079217_11186419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300009148|Ga0105243_10781039All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300009840|Ga0126313_11515309All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300010036|Ga0126305_10002602All Organisms → cellular organisms → Bacteria8273Open in IMG/M
3300010037|Ga0126304_10018047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3981Open in IMG/M
3300010037|Ga0126304_10331426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1011Open in IMG/M
3300010038|Ga0126315_10088411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1757Open in IMG/M
3300010040|Ga0126308_10142938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_68_141505Open in IMG/M
3300010041|Ga0126312_10219480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1331Open in IMG/M
3300010044|Ga0126310_11272019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium594Open in IMG/M
3300010359|Ga0126376_13121727Not Available512Open in IMG/M
3300010362|Ga0126377_11263026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium810Open in IMG/M
3300010399|Ga0134127_10207864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1825Open in IMG/M
3300010400|Ga0134122_10779893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium909Open in IMG/M
3300010400|Ga0134122_11155398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300010403|Ga0134123_13052707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium537Open in IMG/M
3300011000|Ga0138513_100073958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium526Open in IMG/M
3300011119|Ga0105246_11700545All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300012200|Ga0137382_10361131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1020Open in IMG/M
3300012901|Ga0157288_10266537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium583Open in IMG/M
3300012906|Ga0157295_10099448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1795Open in IMG/M
3300012907|Ga0157283_10116968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300012908|Ga0157286_10040668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium1144Open in IMG/M
3300012910|Ga0157308_10213742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300012914|Ga0157297_10368764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300012915|Ga0157302_10130626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium831Open in IMG/M
3300012916|Ga0157310_10054028All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS11172Open in IMG/M
3300014314|Ga0075316_1179121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium549Open in IMG/M
3300014488|Ga0182001_10018261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1610Open in IMG/M
3300014497|Ga0182008_10247204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300014969|Ga0157376_11637745Not Available678Open in IMG/M
3300015371|Ga0132258_12834408All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300017965|Ga0190266_10106831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1165Open in IMG/M
3300018027|Ga0184605_10173220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium975Open in IMG/M
3300018067|Ga0184611_1087933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1071Open in IMG/M
3300018073|Ga0184624_10011012All Organisms → cellular organisms → Bacteria3149Open in IMG/M
3300018073|Ga0184624_10026025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2225Open in IMG/M
3300018081|Ga0184625_10066329All Organisms → cellular organisms → Bacteria → Terrabacteria group1828Open in IMG/M
3300018082|Ga0184639_10477545Not Available633Open in IMG/M
3300018432|Ga0190275_12208493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300018465|Ga0190269_10609505Not Available740Open in IMG/M
3300018476|Ga0190274_10088154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2418Open in IMG/M
3300019356|Ga0173481_10024825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1864Open in IMG/M
3300019361|Ga0173482_10232412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium775Open in IMG/M
3300019377|Ga0190264_11632341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300019869|Ga0193705_1073396Not Available671Open in IMG/M
3300022756|Ga0222622_10237911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1227Open in IMG/M
3300025901|Ga0207688_10055059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium2232Open in IMG/M
3300025901|Ga0207688_10373567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium881Open in IMG/M
3300025908|Ga0207643_10080246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1890Open in IMG/M
3300025919|Ga0207657_10266830Not Available1361Open in IMG/M
3300025923|Ga0207681_10355322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1174Open in IMG/M
3300025927|Ga0207687_10814951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium796Open in IMG/M
3300025935|Ga0207709_10209886All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300025944|Ga0207661_10059531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3078Open in IMG/M
3300026004|Ga0208416_1015141All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300026023|Ga0207677_11042473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium743Open in IMG/M
3300026075|Ga0207708_11724516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300026118|Ga0207675_100187069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1985Open in IMG/M
3300027476|Ga0207514_102436All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300028380|Ga0268265_11566102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium663Open in IMG/M
3300028587|Ga0247828_10607681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium668Open in IMG/M
3300028589|Ga0247818_10279091All Organisms → cellular organisms → Bacteria → Terrabacteria group1108Open in IMG/M
3300028589|Ga0247818_11200077Not Available542Open in IMG/M
3300028717|Ga0307298_10172146All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300028720|Ga0307317_10015543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2297Open in IMG/M
3300028754|Ga0307297_10050812All Organisms → cellular organisms → Bacteria → Terrabacteria group1277Open in IMG/M
3300028754|Ga0307297_10157751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300028811|Ga0307292_10069421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1346Open in IMG/M
3300028814|Ga0307302_10003440All Organisms → cellular organisms → Bacteria6985Open in IMG/M
3300028824|Ga0307310_10022913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2464Open in IMG/M
3300028876|Ga0307286_10103572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1000Open in IMG/M
3300028881|Ga0307277_10000052All Organisms → cellular organisms → Bacteria33466Open in IMG/M
3300028884|Ga0307308_10310594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300028885|Ga0307304_10521120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300030336|Ga0247826_10797291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
3300031547|Ga0310887_10139041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1259Open in IMG/M
3300031731|Ga0307405_10002902All Organisms → cellular organisms → Bacteria7721Open in IMG/M
3300031852|Ga0307410_10054191All Organisms → cellular organisms → Bacteria2718Open in IMG/M
3300031858|Ga0310892_11231070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium534Open in IMG/M
3300031858|Ga0310892_11260682Not Available528Open in IMG/M
3300032017|Ga0310899_10254045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300032080|Ga0326721_10634769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium653Open in IMG/M
3300032179|Ga0310889_10050530All Organisms → cellular organisms → Bacteria → Terrabacteria group1623Open in IMG/M
3300033407|Ga0214472_10002661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria19083Open in IMG/M
3300033550|Ga0247829_11346140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium590Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil8.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.35%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.17%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.59%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.59%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.59%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.59%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.79%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.79%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026004Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027476Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08.2A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_148648202124908045SoilMARDSFPLAVILFVLGWATVARAVLVFAQKLPPTCTSCGRRFERRHLGEPVCRCHG
INPhiseqgaiiFebDRAFT_10515285623300000364SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGEAVCNCHR*
F24TB_1005591723300000550SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGESVCNCHH*
JGI11615J12901_1009331613300000953SoilLVLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
JGI10216J12902_10027287013300000956SoilMARDSFPLAVILFVLGWATVARAVLVFAQKLPPTCTSCGRRFERRHLGEPVCRCGH*
JGI10216J12902_10601548523300000956SoilMLPRDVPLALLLIAMSWMTIARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHNH*
C688J35102_11950644713300002568SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
JGI25406J46586_1006783523300003203Tabebuia Heterophylla RhizosphereMPRDNFPLALMLFILGWVTVARAVLVFVQKLPPTCGRCGRRFERKHLGEPVCRCGA*
soilL1_1002185223300003267Sugarcane Root And Bulk SoilMFPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCRH*
Ga0055471_1023206913300003987Natural And Restored WetlandsDSGSVLPRDVPLALLLVSLAWMTVARAVLVFAQKLPPTCGRCGLKLERRYLGEPVCHCGH
Ga0063454_10016943223300004081SoilMLPRDVPLALLLVSLAWMTVARAVLVFAQKLPPTCRSCGLKLERRYLGESVCHCHH*
Ga0062593_10006069733300004114SoilMLPRDVPLALLLVTMAWMTVARAVLVFTQKLPPTCRDCGMKLERRYLGEPVCSCRHH*
Ga0062593_10070069123300004114SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCSCRH*
Ga0062593_10151182123300004114SoilGLRGRAVSSDTETMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCRCQH*
Ga0062593_10277387223300004114SoilMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHR*
Ga0062593_10356687223300004114SoilRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0062590_10095054023300004157SoilMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCRCQH*
Ga0062590_10122877623300004157SoilMLPRDVPLALLLIGLSWMTIARAVLVFAQKLPPTCRSCGLKLERRYLGEQVCHCNH*
Ga0062590_10288289013300004157SoilPLALLLVTMAWMTVARAVLVFTQKLPPTCRDCGMKLERRYLGEPVCSCRHH*
Ga0063356_10090170833300004463Arabidopsis Thaliana RhizosphereMPRDNFPLAVMLFVLGWATVARAVLVFVQKLPPTCGRCGRRYERKHLGEPVCKCGA*
Ga0062595_10075393913300004479SoilVVSSDSRSMFPRDVPLTLLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSC
Ga0062595_10172640023300004479SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEAVCSCRH*
Ga0066683_1017510023300005172SoilMLPRDVPLALLLIMLSWMTIARAVLVFAQKLPPTCRDCGLKLERRYLGEPVCSCHH*
Ga0070683_10017556833300005329Corn RhizosphereMFPRDVPLTLLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0070680_10077236633300005336Corn RhizosphereMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0070682_10169279613300005337Corn RhizosphereVSSDTETMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCRCQH*
Ga0070674_10075421123300005356Miscanthus RhizosphereGLRSRALSSDTENMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0070697_10095059623300005536Corn, Switchgrass And Miscanthus RhizosphereMPRDIPLALVLFVLAWATVARAVLVFAQKLPPTCDSCGRRFERRHLGEPVCRCHA*
Ga0070697_10156852013300005536Corn, Switchgrass And Miscanthus RhizosphereMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGRKLERRYLGESVCSCHH*
Ga0070686_10157929413300005544Switchgrass RhizosphereLLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH*
Ga0070696_10018038023300005546Corn, Switchgrass And Miscanthus RhizosphereMPRDLPLALVLFVLAWATVARAVLVFAQKLPPTCDSCGRRFERRHLGEPVCRCHA*
Ga0070693_10031645523300005547Corn, Switchgrass And Miscanthus RhizosphereRGRAVSSDTETMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCRCQH*
Ga0068857_10098373323300005577Corn RhizosphereMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH*
Ga0068852_10210858313300005616Corn RhizosphereLLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0068864_10086623513300005618Switchgrass RhizosphereVVSSDSRDMFPRDVPLTLLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0066905_10025634723300005713Tropical Forest SoilVLSSDTEDMFPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGESVCSCRH*
Ga0075287_105298913300005873Rice Paddy SoilMLPRDVPLALLLITMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGEPVCSCHQ*
Ga0081455_1002402193300005937Tabebuia Heterophylla RhizosphereMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCQNCGLKLERRYLGESVCNCHH*
Ga0075432_1037319123300006058Populus RhizosphereMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCNCHH*
Ga0079217_1118641923300006876Agricultural SoilMPRDIPLSLFLLLLLAWVTVARAVLVYAQKLPPTCTSCGRRFQRRHMGEPVCRCVA*
Ga0105243_1078103933300009148Miscanthus RhizosphereTRRMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEAVCSCRH*
Ga0126313_1151530913300009840Serpentine SoilRDVPLSFFLLLLLAWVTVARAVLVFAQKLPPTCRSCGRRFQRRHMGEPVCRCEA*
Ga0126305_1000260243300010036Serpentine SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYVGESVCSCHH*
Ga0126304_1001804723300010037Serpentine SoilMPRDNFPLAVMLFVLGWATVARAVLVFAQKLPPTCGRCGRRFERKHMGEPVCRCGH*
Ga0126304_1033142623300010037Serpentine SoilMPRDNFPLALMLFILGWATVARAVLVFVQKLPPTCGQCGRRFERKHLGEPVCRCGT*
Ga0126315_1008841153300010038Serpentine SoilMPRDNFPLALMLFILGWATVARAVLVFVQKLPPTCGRCGRRFERKHLGEPVCRCGT*
Ga0126308_1014293813300010040Serpentine SoilMEPTLWPTILATIAWLTIARAVLVFAQKLPPTCPRCWLRLERRYLGEAIC
Ga0126312_1021948023300010041Serpentine SoilMPRDVPLSFFLLLLLAWVTVARAVLVFAQKLPPTCGFCGRRFQRRHMGEPVCRCEA*
Ga0126310_1127201923300010044Serpentine SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHR*
Ga0126376_1312172723300010359Tropical Forest SoilMFPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGE
Ga0126377_1126302613300010362Tropical Forest SoilTMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYMGESVCSCHR*
Ga0134127_1020786423300010399Terrestrial SoilMFPRDVPLALVLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0134122_1077989323300010400Terrestrial SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGRKLERRYLGESVCSCHH*
Ga0134122_1115539823300010400Terrestrial SoilMLFVLGWATVARAVLVFVQKLPPTCGRCGRRYERKHLGEPVCKCGA*
Ga0134123_1305270713300010403Terrestrial SoilMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0138513_10007395813300011000SoilNMLPRDVPLALLLVTLAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHR*
Ga0105246_1170054523300011119Miscanthus RhizosphereSDSRNMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH*
Ga0137382_1036113123300012200Vadose Zone SoilMPRDGIPLALVLFVLAWATVARAVLVFAQKLPPTCDSCGRRFERRHLGEPVCRCHA*
Ga0157288_1026653723300012901SoilMFPRDVPLALVLVSMAWMTVARAVLVFAQKLPPTCRNCGLKLERSYLGESVCSCHH*
Ga0157295_1009944833300012906SoilMSDTENMPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGE
Ga0157283_1011696823300012907SoilMPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHR*
Ga0157286_1004066843300012908SoilMPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0157308_1021374213300012910SoilMPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCRCQH*
Ga0157297_1036876413300012914SoilPLALLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH*
Ga0157302_1013062623300012915SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCSCRHH*
Ga0157310_1005402843300012916SoilMFPRDVPLALVLVSMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGE
Ga0075316_117912123300014314Natural And Restored WetlandsMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYQGESVCSCHH*
Ga0182001_1001826133300014488SoilDNFPLALMLFILGWATVARAVLVFVQKLPPTCGQCGRRFERKHLGEPVCRCGT*
Ga0182008_1024720423300014497RhizosphereMLPRDVPLALLLVGLAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGESVCHCHH*
Ga0157376_1163774533300014969Miscanthus RhizosphereMFPRDVPLTLLLISMAWMTVARAVLVFAQKHPPTCRHCGLKLERRYLGE
Ga0132258_1283440833300015371Arabidopsis RhizosphereALSSDTENMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH*
Ga0190266_1010683123300017965SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0184605_1017322033300018027Groundwater SedimentMPRDLPLALVLFVLAWATVARAVLVFAQKLPPTCDSCGRRFERRHLGEPVCRCHA
Ga0184611_108793343300018067Groundwater SedimentMPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGESVCSCHH
Ga0184624_1001101263300018073Groundwater SedimentGLRSRALSSDTENMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0184624_1002602543300018073Groundwater SedimentMPRDNFPLAVMLFVLGWATVARAVLVFVQKLPPTCGRCGRRYERKHLGEPVCKCGA
Ga0184625_1006632933300018081Groundwater SedimentMPRDNFPLAVMLFVLGWATVARAVLVFVQKLPPTCGRCGRRDERKHLGEPVCKCGA
Ga0184639_1047754523300018082Groundwater SedimentMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0190275_1220849323300018432SoilMPRDFPLAFTLFLLGWATIGRALLVFAHKLPPTCGRCGLKLERRHLGERVCRCGS
Ga0190269_1060950523300018465SoilMLPRDVPLALLLVSLAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCSCQH
Ga0190274_1008815443300018476SoilMPRDNFPLAVMLFVLGWATVARAVLVFVQKLPPTCGRCGRRFERKHMGEPVCRCGH
Ga0173481_1002482523300019356SoilMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHR
Ga0173482_1023241223300019361SoilMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGESVCSCHH
Ga0190264_1163234123300019377SoilMPRDVPVSLFLLLLLAWVTVARAVLVYAQKLPPTCRSCGRRFQRRHMGEPVCRCEA
Ga0193705_107339633300019869SoilMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0222622_1023791133300022756Groundwater SedimentMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRNCGLKLERRYLGESVCSCHH
Ga0207688_1005505923300025901Corn, Switchgrass And Miscanthus RhizosphereMFPRDVPLTLLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0207688_1037356723300025901Corn, Switchgrass And Miscanthus RhizosphereVPLALLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH
Ga0207643_1008024643300025908Miscanthus RhizosphereMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH
Ga0207657_1026683023300025919Corn RhizosphereMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGEAVCNCHR
Ga0207681_1035532223300025923Switchgrass RhizosphereMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEAVCSCRH
Ga0207687_1081495123300025927Miscanthus RhizosphereLKARVVSSDSRNMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRHCGLKLERRYLGESVCSCHH
Ga0207709_1020988613300025935Miscanthus RhizosphereLLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0207661_1005953143300025944Corn RhizosphereMFPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCRCQH
Ga0208416_101514123300026004Rice Paddy SoilMLPRDVPLALLLITMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGEPVCSCHQ
Ga0207677_1104247323300026023Miscanthus RhizosphereMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRNCGMKLERRYLGEAVCSCRH
Ga0207708_1172451613300026075Corn, Switchgrass And Miscanthus RhizosphereRYGRNMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGRKLERRYLGESVCSCH
Ga0207675_10018706933300026118Switchgrass RhizosphereMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGRKLERRYLGESVCSCHH
Ga0207514_10243613300027476SoilMLPRDVPLALLLIGLSWMTIARAVLVFAQKLPPTCRSCGLKLERRYLGEQVCHC
Ga0268265_1156610223300028380Switchgrass RhizosphereMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGEAVCNCHR
Ga0247828_1060768123300028587SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGRKLERRYLGESVCSCHH
Ga0247818_1027909113300028589SoilFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGRKLERRYLGESVCSCHH
Ga0247818_1120007723300028589SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEDEH
Ga0307298_1017214623300028717SoilMLPRDVPLALLLVTLAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCNCGH
Ga0307317_1001554343300028720SoilMLPRDVPLALLLVTLAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCNCRH
Ga0307297_1005081223300028754SoilMFPRDVPLALLLISMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHR
Ga0307297_1015775123300028754SoilMLPRDVPLALLLVTMAWMTVARAVLVFTQKLPPTCRDCGMKLERRYLGEPVCSCRHH
Ga0307292_1006942133300028811SoilALLLVTLAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCNCGH
Ga0307302_1000344063300028814SoilMPRDNFPLAVMLFVLGWATVARAVLVFAQKLPPTCGRCGRRFERKHMGEPVCRCGH
Ga0307310_1002291343300028824SoilDERASGRYETQMPRDLPLALVLFVLAWATVARAVLVFAQKLPPTCDSCGRRFERRHLGEPVCRCHA
Ga0307286_1010357223300028876SoilMPRDNFPLAVMLFVLSWATVARAVLVFVQKLPPTCGRCGRRYERKHLGEPVCKCGA
Ga0307278_1046378223300028878SoilLLVSLAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEPVCSCQH
Ga0307277_10000052373300028881SoilMPRDNFPLAVMLFVLGWATVARAVLVFVQKLPPTCGRCGRRFERKHLGEPVCRCGA
Ga0307308_1031059423300028884SoilTLQTSSKDGRASGRYETQMPRDLPLALVLFVLAWATVARAVLVFAQKLPPTCDSCGRRYERRHMGEPVCRCHA
Ga0307304_1052112023300028885SoilMLPRDVPLALLLVTMAWMTVARAVLVFTQKLPPTCRDCGMKLERRYLGEPVCSCQH
Ga0247826_1079729123300030336SoilLLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0310887_1013904123300031547SoilMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCNCHH
Ga0307405_10002902103300031731RhizosphereMPRDNFPLAVMLFVLGWATVARAVLVFAQKLPPTCGRCGRRFERNHMGEPVCRCGH
Ga0307410_1005419113300031852RhizosphereMPRDNFPLAVMLFVLGWATVARAVLVFAQKLPPTCGRCGRRFERNHMGEPV
Ga0310892_1123107013300031858SoilRSMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0310892_1126068223300031858SoilMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYL
Ga0310899_1025404523300032017SoilGVVSSDSRSMFPRDVPLALLLICMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0326721_1063476913300032080SoilFVRYGKNMPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCSCHH
Ga0310889_1005053033300032179SoilMLPRDVPLALLLVTMAWMTVARAVLVFAQKLPPTCRDCGLKLERRYLGESVCNCHH
Ga0214472_10002661153300033407SoilMQQLPLALVLFLVAWATVARAVLVFTQKLPPTCGACGLRYERRYLGERVCRCS
Ga0247829_1134614023300033550SoilMLPRDVPLALLLVSMAWMTVARAVLVFAQKLPPTCRDCGMKLERRYLGEAVCSCRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.