NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066528

Metagenome / Metatranscriptome Family F066528

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066528
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 69 residues
Representative Sequence MIATYATAADFTTWAERAKLMTVAELLYTVNDCRQAAEAMRGWNPIKEGFYMDQASTYGMELNRR
Number of Associated Samples 107
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 32.54 %
% of genes near scaffold ends (potentially truncated) 22.22 %
% of genes from short scaffolds (< 2000 bps) 69.05 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (73.810 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(19.841 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(33.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.84%    β-sheet: 0.00%    Coil/Unstructured: 45.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.34.15.1: Hypothetical protein YfhHd1sf9a11sf90.737
a.118.1.25: RPA1889-liked2i9ca12i9c0.721
a.124.1.1: Phospholipase Cd1p5xa_1p5x0.72066
a.2.2.1: Ribosomal protein L29 (L29p)d1vq8v11vq80.71913
f.20.1.1: Clc chloride channeld4enea_4ene0.71523

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF08774VRR_NUC 5.56
PF05866RusA 2.38
PF13361UvrD_C 2.38
PF13391HNH_2 2.38
PF04851ResIII 1.59
PF13264DUF4055 1.59
PF03837RecT 1.59
PF12684DUF3799 1.59
PF00692dUTPase 1.59
PF03330DPBB_1 1.59
PF08401ArdcN 0.79
PF02511Thy1 0.79
PF01555N6_N4_Mtase 0.79
PF04984Phage_sheath_1 0.79
PF07275ArdA 0.79
PF03237Terminase_6N 0.79
PF02223Thymidylate_kin 0.79
PF00580UvrD-helicase 0.79
PF05272VirE 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG4570Holliday junction resolvase RusA (prophage-encoded endonuclease)Replication, recombination and repair [L] 2.38
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 1.59
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 1.59
COG3723Recombinational DNA repair protein RecTReplication, recombination and repair [L] 1.59
COG0125Thymidylate kinaseNucleotide transport and metabolism [F] 0.79
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.79
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.79
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.79
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.79
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.79
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.79
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 0.79
COG3973DNA helicase IVReplication, recombination and repair [L] 0.79
COG4227Antirestriction protein ArdCReplication, recombination and repair [L] 0.79
COG4734Antirestriction protein ArdADefense mechanisms [V] 0.79
COG5545Predicted P-loop ATPase and inactivated derivativesMobilome: prophages, transposons [X] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.30 %
UnclassifiedrootN/A12.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10053943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011738Open in IMG/M
3300000756|JGI12421J11937_10088295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01877Open in IMG/M
3300000756|JGI12421J11937_10099597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01796Open in IMG/M
3300000756|JGI12421J11937_10151474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01573Open in IMG/M
3300001847|RCM41_1113468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01880Open in IMG/M
3300004804|Ga0007796_10059554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011239Open in IMG/M
3300005512|Ga0074648_1009996All Organisms → cellular organisms → Bacteria6373Open in IMG/M
3300005512|Ga0074648_1015329All Organisms → cellular organisms → Bacteria4646Open in IMG/M
3300005512|Ga0074648_1065570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1459Open in IMG/M
3300005512|Ga0074648_1185351All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005613|Ga0074649_1016718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp.4482Open in IMG/M
3300006025|Ga0075474_10152650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01724Open in IMG/M
3300006868|Ga0075481_10255460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01617Open in IMG/M
3300007539|Ga0099849_1341874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01533Open in IMG/M
3300007542|Ga0099846_1347927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01502Open in IMG/M
3300007960|Ga0099850_1322245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01583Open in IMG/M
3300008116|Ga0114350_1000596Not Available22881Open in IMG/M
3300009085|Ga0105103_10095319All Organisms → Viruses → Predicted Viral1541Open in IMG/M
3300009149|Ga0114918_10081534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2056Open in IMG/M
3300009158|Ga0114977_10105318Not Available1708Open in IMG/M
3300009450|Ga0127391_1110520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01520Open in IMG/M
3300009451|Ga0127402_1050880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01903Open in IMG/M
3300009469|Ga0127401_1016894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM012142Open in IMG/M
3300009470|Ga0126447_1073157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01839Open in IMG/M
3300009504|Ga0114946_10381660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01732Open in IMG/M
3300009908|Ga0132233_101080Not Available812Open in IMG/M
3300010354|Ga0129333_10014006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7621Open in IMG/M
3300010354|Ga0129333_10437998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011152Open in IMG/M
3300010354|Ga0129333_11297243Not Available602Open in IMG/M
3300011339|Ga0153700_10068Not Available42152Open in IMG/M
3300012000|Ga0119951_1045105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H11302Open in IMG/M
3300012706|Ga0157627_1121367All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon918Open in IMG/M
3300012707|Ga0157623_1158960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01636Open in IMG/M
3300012717|Ga0157609_1040529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01728Open in IMG/M
3300012719|Ga0157600_1063025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01555Open in IMG/M
3300012721|Ga0157612_1083580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3413Open in IMG/M
3300012722|Ga0157630_1284424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011190Open in IMG/M
3300012920|Ga0160423_10103708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM012010Open in IMG/M
3300012920|Ga0160423_10409811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01926Open in IMG/M
3300012928|Ga0163110_11037271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01654Open in IMG/M
3300012936|Ga0163109_10918342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01640Open in IMG/M
3300012959|Ga0157620_1087072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01514Open in IMG/M
3300013005|Ga0164292_10678033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01660Open in IMG/M
3300016691|Ga0180055_1160764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01626Open in IMG/M
3300016699|Ga0180058_1211352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01576Open in IMG/M
3300017714|Ga0181412_1012531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM012522Open in IMG/M
3300017719|Ga0181390_1091088Not Available828Open in IMG/M
3300017725|Ga0181398_1054878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01961Open in IMG/M
3300017725|Ga0181398_1064317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01882Open in IMG/M
3300017728|Ga0181419_1020417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011861Open in IMG/M
3300017741|Ga0181421_1020696Not Available1796Open in IMG/M
3300017742|Ga0181399_1005397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3960Open in IMG/M
3300017746|Ga0181389_1000450All Organisms → cellular organisms → Bacteria16846Open in IMG/M
3300017746|Ga0181389_1005544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium4435Open in IMG/M
3300017750|Ga0181405_1043032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011201Open in IMG/M
3300017751|Ga0187219_1163309Not Available635Open in IMG/M
3300017767|Ga0181406_1197017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01599Open in IMG/M
3300017783|Ga0181379_1346435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01500Open in IMG/M
3300017951|Ga0181577_10073947All Organisms → Viruses2390Open in IMG/M
3300019745|Ga0194002_1002732All Organisms → Viruses → Predicted Viral1792Open in IMG/M
3300019756|Ga0194023_1003401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H13180Open in IMG/M
3300019765|Ga0194024_1150024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1547Open in IMG/M
3300019784|Ga0181359_1124817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1916Open in IMG/M
3300020056|Ga0181574_10418317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01776Open in IMG/M
3300020161|Ga0211726_10412575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01699Open in IMG/M
3300020179|Ga0194134_10051726All Organisms → cellular organisms → Bacteria2260Open in IMG/M
3300020183|Ga0194115_10084385All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1828Open in IMG/M
3300020414|Ga0211523_10398388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01557Open in IMG/M
3300020461|Ga0211535_10058071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1622Open in IMG/M
3300021356|Ga0213858_10141740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011174Open in IMG/M
3300021373|Ga0213865_10048594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2352Open in IMG/M
3300021373|Ga0213865_10148556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011203Open in IMG/M
3300021378|Ga0213861_10571593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01524Open in IMG/M
3300021379|Ga0213864_10023856Not Available2805Open in IMG/M
3300022065|Ga0212024_1016987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011157Open in IMG/M
3300022067|Ga0196895_1005808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011306Open in IMG/M
3300022068|Ga0212021_1041691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01918Open in IMG/M
(restricted) 3300024255|Ga0233438_10000520Not Available48831Open in IMG/M
3300024262|Ga0210003_1088520Not Available1437Open in IMG/M
3300025120|Ga0209535_1000389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes30759Open in IMG/M
3300025135|Ga0209498_1183917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01769Open in IMG/M
3300025483|Ga0209557_1015870All Organisms → Viruses2602Open in IMG/M
3300025606|Ga0207954_1114178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01658Open in IMG/M
3300027142|Ga0255065_1027763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011083Open in IMG/M
3300027608|Ga0208974_1106506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01744Open in IMG/M
3300027733|Ga0209297_1051884Not Available1851Open in IMG/M
3300027797|Ga0209107_10060253All Organisms → Viruses → Predicted Viral2117Open in IMG/M
3300027797|Ga0209107_10109775All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011464Open in IMG/M
3300027797|Ga0209107_10471085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01562Open in IMG/M
3300028196|Ga0257114_1272905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01594Open in IMG/M
3300029318|Ga0185543_1067956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01729Open in IMG/M
3300031539|Ga0307380_10144831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Cyanophage S-2L2369Open in IMG/M
3300031565|Ga0307379_10198778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM012054Open in IMG/M
3300031566|Ga0307378_10036199Not Available5660Open in IMG/M
3300031707|Ga0315291_10777201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1837Open in IMG/M
3300031707|Ga0315291_10781768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01834Open in IMG/M
3300031746|Ga0315293_11214039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01523Open in IMG/M
3300031758|Ga0315907_10129977All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300031772|Ga0315288_11616825All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01527Open in IMG/M
3300031834|Ga0315290_11292083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01602Open in IMG/M
3300031857|Ga0315909_10537871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01797Open in IMG/M
3300031951|Ga0315904_10110887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM012861Open in IMG/M
3300031952|Ga0315294_11037366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01680Open in IMG/M
3300031997|Ga0315278_10127107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM012591Open in IMG/M
3300031997|Ga0315278_11152906All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01763Open in IMG/M
3300031999|Ga0315274_11511885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1637Open in IMG/M
3300032053|Ga0315284_10792144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011098Open in IMG/M
3300032164|Ga0315283_11657458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01649Open in IMG/M
3300032177|Ga0315276_11376186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01738Open in IMG/M
3300032401|Ga0315275_12087151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01595Open in IMG/M
3300033993|Ga0334994_0009802Not Available6601Open in IMG/M
3300033996|Ga0334979_0001580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes16765Open in IMG/M
3300034061|Ga0334987_0008684Not Available9559Open in IMG/M
3300034061|Ga0334987_0110586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H12091Open in IMG/M
3300034062|Ga0334995_0036977Not Available4126Open in IMG/M
3300034062|Ga0334995_0095373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H12271Open in IMG/M
3300034063|Ga0335000_0005992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales9756Open in IMG/M
3300034071|Ga0335028_0114846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1749Open in IMG/M
3300034073|Ga0310130_0088214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01928Open in IMG/M
3300034102|Ga0335029_0542081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01666Open in IMG/M
3300034106|Ga0335036_0023861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4877Open in IMG/M
3300034109|Ga0335051_0178359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011072Open in IMG/M
3300034111|Ga0335063_0005858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7875Open in IMG/M
3300034111|Ga0335063_0020098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4297Open in IMG/M
3300034111|Ga0335063_0187827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011171Open in IMG/M
3300034283|Ga0335007_0160259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011601Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater19.84%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment10.32%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.32%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.35%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment4.76%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.97%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater3.17%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment3.17%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond3.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.38%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.38%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.38%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.59%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.59%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.59%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.79%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.79%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.79%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.79%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.79%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.79%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.79%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.79%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300001847Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2aEnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009450Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009451Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009504Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep SedimentEnvironmentalOpen in IMG/M
3300009908Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, Depth 6m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012719Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012959Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300016691Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016699Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020056Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020461Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025135Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025606Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)EnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1005394323300000116MarineMERHATANDFANWQAQAAGMTNSELLWTVRDCQRAESAMRGWNPIKEGFYSDQKATYGMELTKRRQR*
JGI12421J11937_1008829523300000756Freshwater And SedimentMIQAYATAEDFTTWETMARTMTADELRYAARDCRQAEAAMRGWNPIREGFYSDQACTFGDELRRRQGR*
JGI12421J11937_1009959713300000756Freshwater And SedimentMIQAYATADDFTAWETKARTMTADELRYAARDCRQAEAAMRGWNPIREGFYSDQAHTFGDELRRRQGR*
JGI12421J11937_1015147433300000756Freshwater And SedimentGDSRQDLHPNPRAMIATYATAADFTTWCERAKSMTVAELLYTVNDCRQAAESMRGWNPIKEGFYMDQASTYGMELNRR*
RCM41_111346823300001847Marine PlanktonMKNEYATPEDFATWEARAKTMTDAELLYTVRDCQQAEAAMRGWNPIKEGYYSDQACTYGMELTRRRRQGR*
Ga0007796_1005955413300004804FreshwaterMTATEHATAADFTAWAAKAKTMTVDELLYAANDCREAEKAMRGWNPIKEGYYSDQACTYGDELRRRAQAA*
Ga0074648_100999643300005512Saline Water And SedimentMRPEYALPSDFADWEAKAKTMTVAELLYTVKDCQQAAQCMKGFNPDKEGFYVDQACTYGMELTRRQRAR*
Ga0074648_101532943300005512Saline Water And SedimentMITLHATAADFDAWETKARTMTNAELLYAARDCREAEEAMRGWNPIREGYYSDQASTYGMELKRRADQLRQSNK*
Ga0074648_106557033300005512Saline Water And SedimentMIATYATAADFTTWAERAKLMTVAELLYTVNDCRQAAEAIRGWNPIKEGFYMDQASTYGMELNRR*
Ga0074648_118535113300005512Saline Water And SedimentMRPEYALPSDFATWEAKAKTMSVAALLYAVRDCQEAATAMKGWNPEKEGFYLDQASTYGMELTRRRAA*
Ga0074649_101671843300005613Saline Water And SedimentMIATYATAADFTTWAERAKLMTVAELLYTVNDCRQAAEAMRGWNPIKEGFYMDQASTYGMELNRR*
Ga0075474_1015265013300006025AqueousMERHATANDFSNWQAQAAGMTNCELLWTVRDCQRAESAMRGWNPIKEGFYSDQKATYGMELTKRRQR*
Ga0075481_1025546023300006868AqueousMIATYATAADFTNWAERAKSMTVAELLYTVNDCHQAAESMRGWNPIKEGFYMDQASTYKMELNRR*
Ga0099849_134187423300007539AqueousMTANYATAADFTAWTERAKGMTVAALLYTINDCRQAAEAMRGWNPIKEGFYMDQACTYGMELSRRKAA*
Ga0099846_134792713300007542AqueousMTATEYATAADFAAWELRAKSMTDAELLYTVRDCQQAEAAMRGWNPIKEGFYSDQASTYGMELTRRRRAMGLTGPV*
Ga0099850_132224513300007960AqueousMTVTEYATAADFSRWEARAKAMTDAELLHTVKDCQQAEAAMRGWNPIKEGFYSDQASTYGMELTRRRRAMGLTGPV*
Ga0114350_1000596373300008116Freshwater, PlanktonMLSQPHAPRIMATTEFATAADFANWANRAKSMTSAELLYTVNDCQRAAKAMRGWNPVKEGFYVDQACTYGMELTRRRRSVA*
Ga0105103_1009531933300009085Freshwater SedimentMIQEYATAADFTRWREQAERMSIAELYYAAADCRQAEYAMRGWNPIREGYYSDQACTFGDEIRRRNPAR*
Ga0114918_1008153423300009149Deep SubsurfaceMIATYATAADFTTWGERAKSMTVAELLYTVSDCRQAAESMRGWNPIKEGFYMDQASTYGMELNRR*
Ga0114977_1010531833300009158Freshwater LakeMTTTYATAADFTTWGERAKSMTVAALRYTVNDCHKAAEAMRGWDPIKEGFYMDQASTYGMELNRR*
Ga0127391_111052023300009450Meromictic PondMTEYATPADFANWEAKAKAMTVAQLLYTVKDCQQAEAAMRGWNPVKEGYYSDQASTYGMELTRRRRA*
Ga0127402_105088013300009451Meromictic PondMVDFERTNPPETMTEYATPADFANWEAKAKAMTVAQLLYTVKDCQQAEAAMRGWNPVKEGYYSDQASTYGMELTRRRRA*
Ga0127401_101689413300009469Meromictic PondMVDFERTDAPETMTEYATPADFANWEAKAKAMTVAQLLYTVKDCQQAEAAMRGWNPVKEGYYSDQASTYGMELTRRRRA*
Ga0126447_107315713300009470Meromictic PondAPTGWGLVPLALPVVLFQRTDAPETMTEYATPADFANWEAKAKAMTVAQLLYTVKDCQQAEAAMRGWNPVKEGYYSDQASTYGMELTRRRRA*
Ga0114946_1038166023300009504SedimentMIATYATAADFTTWGERAKSMTVAELLYTVNDCRQAAESMRGWNPIKEGFYMDQASTYGMELSRR*
Ga0132233_10108013300009908Meromictic PondPETMTEYATPADFANWEAKAKAMTVAQLLYTVKDCQQAEAAMRGWNPVKEGYYSDQASTYGMELTRRRRA*
Ga0129333_1001400673300010354Freshwater To Marine Saline GradientMRPEYALPADFTAWEAKAKIMTIAELLWTVKDCQEAAACMKGFNPDKEGFYIDQACTFGMELTRRKAS*
Ga0129333_1043799813300010354Freshwater To Marine Saline GradientMRPEYATPADFTAWEAKAKSMTVAELLYTVKDCQQAEAAMRGWNPVKEGFYSDQASTYGMELTRRARVAA*
Ga0129333_1129724313300010354Freshwater To Marine Saline GradientMIQDYATPEDFAKWEAQAKAMTDAELLYAARDCRQAEAAMRGWNPIKEGYYSDQACTYGMELNRRRNRR*
Ga0153700_10068233300011339FreshwaterMTTAYATAADFTTWGERAKSMTVAALLYTVNDCHKAADAMRGWNPIKEGFYMDQASTYGMELNRR*
Ga0119951_104510513300012000FreshwaterMRSEYATPADFASWEAKAKTMTVAELLYTVRDCQQAEAAMRGWNPVKEGFYSDQACTYGMELSRRRAA*
Ga0157627_112136713300012706FreshwaterMSNHATAADFTTWAARAKEMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELDRRRAA*
Ga0157623_115896023300012707FreshwaterMTTEHATAEQFTTWAARAKGMTVAALLYTVNDCREAAEAMRGWNPVKEGFYMDQLSTYRQELDRRRAA*
Ga0157609_104052923300012717FreshwaterMTTEHATAEQFTTWAARAKGMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELARRRAA*
Ga0157600_106302513300012719FreshwaterMTTEHATAEQFTTWAARAKGMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELDRRRAA*
Ga0157612_108358013300012721FreshwaterMATEHATAEQFTTWAARAKGMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELDRRRAA*
Ga0157630_128442433300012722FreshwaterMSNHATAADFTTWAARAKEMTVAALLYTVNDCREAAEAMRGWNPVKEGFYMDQLSTYRQELARRRAA*
Ga0160423_1010370863300012920Surface SeawaterMITLHATPADFQAWEAKARTMTTAELLHAARDCREAEAAMKGWNPAREGFYSDQASTYGMELNRRRSA*
Ga0160423_1040981123300012920Surface SeawaterMITLHATPADFQAWEAKARTMTTAELLHAARDCSEAEAAMKGWNPAREGFYSDQASTYGMELNRRRSA*
Ga0163110_1103727133300012928Surface SeawaterHATPADFQAWEAKARTMTTAELLHAARDCREAEAAMKGWNPAREGFYSDQASTYGMELNRRRSA*
Ga0163109_1091834213300012936Surface SeawaterPMITLHATPADFQAWEAKARTMTTAELLHAARDCREAEAAMRGWNPAREGFYSDQASTYGMELNRRRSA*
Ga0157620_108707223300012959FreshwaterFTTWAARAKEMTVAALLYTVNDCREAAEAMRGWNPVKEGFYMDQLSTYRQELDRRRAA*
Ga0164292_1067803313300013005FreshwaterPLTTFPPMSNHATAADFTTWAARAKEMTVAALLYTVNDCREAAEAMRGWNPVKEGFYMDQLSTYRQELARRRAA*
Ga0180055_116076423300016691FreshwaterPLTTFPPMSNHATAADFTTWAARAKEMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELDRRRAA
Ga0180058_121135223300016699FreshwaterMSNHATAADFTTWAARAKEMTVAALLYIVNDCREAAEAMRGWNPVKEGFYMDQLSTYRQELARRRAA
Ga0181412_101253143300017714SeawaterMRPEYATAQDFATWEARAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGYYSDQASTFGMELTRRRRHAREIAAACKGK
Ga0181390_109108823300017719SeawaterMRPEYATAQDFSNWEARAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGFYSDQASTFGMELTRRRRHAREIAAACKGK
Ga0181398_105487813300017725SeawaterPATPQGFATLEPMGKAMIAGGLLFPVKDFQEAEAAMRGHNPVKEGFYSDQASTFGMELTRRRRSA
Ga0181398_106431733300017725SeawaterRPEYATAQDFSNWEAVAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGYYSDQASTFGMELTRRRRHAREIAAACKGK
Ga0181419_102041733300017728SeawaterMRPEHATPQDFATWETRAKAMSAAELLFTVKDCQEAEAAMRGHNPVKEGFYSDQASTFGMELTRRRRSA
Ga0181421_102069633300017741SeawaterMNAEYATAQDFATWEARAKTMTVAELLYTVKDCQEAEAAMRGHNPVKEGFYSDQACTYGMELTARRRA
Ga0181399_100539763300017742SeawaterMRPEYATAQDFATWEARAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGYYSDQASTFGMELTRRSRHAREIAAACKGK
Ga0181389_100045053300017746SeawaterMRPEYATAQDFSNWEARAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGFYSDQASTYGMELTRRRRHAREIAAACKGK
Ga0181389_100554493300017746SeawaterMRPEYATAQDFATWEARAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGFYSDQASTFGMELTRRRRHAREIAAACKGK
Ga0181405_104303243300017750SeawaterMSEYATPQDFTNWENKAKDMTVSELLYTIKDCQEAEKNMRGWNPIKEGYYSDQACTYGIL
Ga0187219_116330923300017751SeawaterMRPEYATAQDFSNWEARAKFMTAAELLYTVKDCQEAEAAMRGHNPVKEGFYSDQASTYGM
Ga0181406_119701733300017767SeawaterFTNWENKAKDMTVSELLYTIKDCQEAEKNMRGWNPIKEGYYSDQACTYGMELTRRNRK
Ga0181379_134643523300017783SeawaterMSEYATPQDFTNWENKAKDMTVSELLYTIKDCQEAEKNMRGWNPIKEGYYSDQACTYGMELTRRNRK
Ga0181577_1007394743300017951Salt MarshMRPEYALPSDFATWEAKAKTMTAAALLYAVRDCQDAATAMKGWNPDKEGFYLDQASTYGMELTRRRAA
Ga0194002_100273263300019745SedimentMTAEYATPADFAKWEAQAKEMTDAELLYTVRDCQQAEAAMRGWNPVKEGYYSDQASTFGMELTRRRRVAG
Ga0194023_100340153300019756FreshwaterMTANYATAADFTAWTERAKGMTVAALLYTINDCRQAAEAMRGWNPIKEGFYMDQACTYGMELSRRKAA
Ga0194024_115002413300019765FreshwaterMIATYATAADFTNWAERAKSMTVAELLYTVNDCHQAAESMRGWNPIKEGFYMDQASTYKMELNRR
Ga0181359_112481723300019784Freshwater LakeMAAGGVGFWDSRQPALRPNPRTMTATYATAADFTNWAERAKSMTVAELLYTVNDCHQAAESMRGWNPIKEGFYMDQASTYGMELNRR
Ga0181574_1041831713300020056Salt MarshMRPEYALPSDFATWEAKAKTMTAAALLYAVRDCQEAATAMKGWNPDKEGFYLDQASTYGMELTRRRAA
Ga0211726_1041257523300020161FreshwaterMLTEYATAADFQRWREQAERMTLAELYYSAADCRQAEYAMRGWNPVKEGYYSDQACTFGDEIRRRKMR
Ga0194134_1005172653300020179Freshwater LakeMIATYATAADFTAWTERAKSMTVAELLYTINDCRQAAEAMRGWNPIKEGFYMDQASTYGMELNRR
Ga0194115_1008438543300020183Freshwater LakeMTTEHATAADFTTWEARAKTMTVAELLYTVQDCQQAEAAMRGWNPAKEGFYSDQASTYGMELTRRRRAA
Ga0211523_1039838823300020414MarineMITAHATPADFQAWETKARTMSTAELLHAARDCREAEEAMRGWNPAREGFYSDQAAT
Ga0211535_1005807113300020461MarinePADFKAWETKARTMSTAELLHAARDCREAEEAMRGWNPAREGFYSDQASTYGMELNRRRA
Ga0213858_1014174023300021356SeawaterMRPEYALPSDFATWEAKAKTMSVAALLYTVRDCQEAATAMKGWNPDKEGFYLDQASTYGMELTRRRAA
Ga0213865_1004859423300021373SeawaterMRPEYALPSDFATWEAKAKTMSVAALLYTVRDCQEAATAMKGWNPKKEGFYLDQASTYGMELTRRRAA
Ga0213865_1014855623300021373SeawaterMTEYATPADFAKWEANAKAMTVAELLYTVKDCREAEAAMRGWNPVKEGFYSDQASTYGMELTRRRRG
Ga0213861_1057159313300021378SeawaterMERHATANDFANWQAQAAGMTNSELLWTVRDCQRAESAMRGWNPIKEGFYSDQKATYGMELTKRRQR
Ga0213864_1002385613300021379SeawaterMITLHATAADFEAWETKARTMSSAELFYAARDCREAEEAMRGWNPIREGYYSDQSSTYGMELKRRADE
Ga0212024_101698743300022065AqueousMERHATANDFSNWQAQAAGMTNSELLWTVRDCQRAESAMRGWNPIKEGFYSDQKATYGMELTKRRQR
Ga0196895_100580813300022067AqueousMERHATANDFSNWQAQAAGMTNCELLWTVRDCQRAESAMRGWNPIKEGFYSDQKATYGMELTKRRQR
Ga0212021_104169133300022068AqueousYKTTPDHHMERHATANDFSNWQAQAAGMTNSELLWTVRDCQRAESAMRGWNPIKEGFYSDQKATYGMELTKRRQR
(restricted) Ga0233438_1000052073300024255SeawaterMTEYATAADFCKWEAQAKAMTTAGLLYTIKDCREAESAMCGHNPVKEGYYSDQASTFGMELNRRKAKAA
Ga0210003_108852013300024262Deep SubsurfaceMIATYATAADFTTWGERAKSMTVAELLYTVSDCRQAAESMRGWNPIKEGFYMDQASTYGMELNRR
Ga0209535_1000389313300025120MarineMRPEFATPQDFATWEARAKAMSAAELLFTVKDCQEAEAAMRGHNPVKEGFYSDQASTFGMELTRRRRSA
Ga0209498_118391733300025135SedimentMIATYATAADFTTWGERAKSMTVAELLYTVNDCRQAAESMRGWNPIKEGFYMDQASTYGMELSRR
Ga0209557_101587033300025483MarineMLPHTYLNAAPHPMNAEYATAQDFATWEARAKTMTVAELLYTVKDCQEAEAAMRGHNPVKEGFYSDQACTYGMELTARRRA
Ga0207954_111417823300025606FreshwaterMTATEHATAADFTAWAAKAKTMTVDELLYAANDCREAEKAMRGWNPIKEGYYSDQACTYGDELRRRAQAA
Ga0255065_102776323300027142FreshwaterMIQEYATAADFTRWREQAERMSIAELYYAAADCRQAEYAMRGWNPIREGYYSDQACTFGDEIRRRNPAR
Ga0208974_110650633300027608Freshwater LenticMIATYATAADFTTWGERAKSMTVAELLYTVNDCRQAAESMRGWNPIKEGFYMDQASTYGMELNRR
Ga0209297_105188453300027733Freshwater LakeMTTTYATAADFTTWGERAKSMTVAALRYTVNDCHKAAEAMRGWDPIKEGFYMDQASTYGMELNRR
Ga0209107_1006025313300027797Freshwater And SedimentMIQAYATAEDFTTWETMARTMTADELRYAARDCRQAEAAMRGWNPIREG
Ga0209107_1010977543300027797Freshwater And SedimentMIQAYATADDFTAWETKARTMTADELRYAARDCRQAEAAMRGWNPIREGFYSDQAHTFGDELRRRQGR
Ga0209107_1047108513300027797Freshwater And SedimentMIATYATAADFTTWCERAKSMTVAELLYTVNDCRQAAESMRGWNPIKEGFYMDQASTYGMELNRR
Ga0257114_127290513300028196MarineATDFANWAAAAALMTSAELLWTVRDCQQAESAMRGWNPVKEGYYSDQASTYGMELMRRKQ
Ga0185543_106795613300029318MarineMITAHATPADFQAWETKARTMSTAELLHAARDCREAEEAMRGWNPAREGFYSDQAATYGMELNRRRSA
Ga0307380_1014483133300031539SoilMIDLHATAEDFASWAAKAKTMTISELLYAAKDCREAEAAMRGWNPIREGYYSDQASTYGMELRNRKVAA
Ga0307379_1019877853300031565SoilMIDLHATAEDFANWQAKAKTMTISELLYAAKDCREAEAAMRGWNPIREGYYSDQASTYGMELRNRKVAA
Ga0307378_1003619913300031566SoilMIDLHATAEDFANWQAKAKTMTISELLYAAKDCREAEAAMRGWNPIREGYYSDQASTYGM
Ga0315291_1077720133300031707SedimentMITTYATAANFTIWGERAKSMTVAALLYTVNDCHKAAEAMRGWNPIKEGFYMDQASTYGMELNRR
Ga0315291_1078176833300031707SedimentMGTGGESFHPTPKAMIATYATAADFTTWGERAKSMTVAELLYTVNDCCQAAESMTGWNPIKENFYMDQACTYGMELSRR
Ga0315293_1121403923300031746SedimentYATAADFTTWGERAKSMTVAELLYTVNDCCQAAESMTGWNPIKENFYMDQACTYGMELSR
Ga0315907_1012997753300031758FreshwaterMLSQPHAPRIMATTEFATAADFANWANRAKSMTSAELLYTVNDCQRAAKAMRGWNPVKEGFYVDQACTYGMELTRRRRSVA
Ga0315288_1161682513300031772SedimentMTTTYATAADFTTWGERAKSMTVAALLYTVNDCHKAAEAMRGWNPIKEGFYMDQASTYGMELNRR
Ga0315290_1129208313300031834SedimentTGGESFLHKPRAMIATYATAADFTTWGERAKSMTVAELLYTVNDCCQAAESMTGWNPIKENFYMDQACTYGMELSRR
Ga0315909_1053787113300031857FreshwaterMAAEHATAADFTNWAERAKSMTAAALIYAINDCRQAAEMMRGWNPVKEGFYMDQAST
Ga0315904_1011088753300031951FreshwaterMAAEHATAADFTNWAERAKSMTAAALIYAINDCRQAAEMMRGWNPVKEGFYMDQASTYGMELNRRKAA
Ga0315294_1103736613300031952SedimentMGTGGESFLHKPRAMIATYATAADFTTWGERAKSMTVAELLYTVNDCCQAAESMTGWNPIKENFYMDQACTYGMELSRR
Ga0315278_1012710773300031997SedimentMTDLHATAEDFANWQAKAKTMTVSELLYAAKDCREAEQAMRGWNPIREGYYSDQACTYGMELNSRKVAA
Ga0315278_1115290623300031997SedimentMIDLHATAEDFANWQAKAKTMTISELLYAAKDCREAEQAMRGWNPIREGYYSDQACTYGMELNSRKVAA
Ga0315274_1151188523300031999SedimentMITTYATAADFTTWGERAKSMTVAALLYTVNDCHKAAEAMRGWNPIKEGFYMDQASTYGMELNRR
Ga0315284_1079214433300032053SedimentMTDLHATAEDFANWQAKAKTMTISELLYAAKDCREAEAAMRGWNPIREGYYSDQASTYGMELHNRKVAA
Ga0315283_1165745813300032164SedimentRAHPMIDLHATAEDFANWQAKAKTMTISELLYAAKDCREAEQAMRGWNPIREGYYSDQACTYGMELNSRKVAA
Ga0315276_1137618633300032177SedimentMGTGGESLLHKPRAMIATYATAADFTTWGERAKSMTVAELLYTVNDCCQAAESMTGWNPIKENFYMDQACTYGMELSRR
Ga0315275_1208715133300032401SedimentTTWGERAKSMTVAELLYTVNDCCQAAESMTGWNPIKENFYMDQACTYGMELSRR
Ga0334994_0009802_1963_21723300033993FreshwaterMRSEYATPADFASWEAKAKTMTVAELLHTVRDCQQAEAAMRGWNPVKEGFYSDQACTYGMELSRRRRAA
Ga0334979_0001580_13225_134313300033996FreshwaterMTTEHATAEQFTTWAARAKGMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELDRRRAA
Ga0334987_0008684_2864_30733300034061FreshwaterMIQEYATAADFTRWREQAERMSIAELYYAAADCRQAEYAMRGWNPIREGYYSDQACTFGDEIRRRNLAR
Ga0334987_0110586_1285_14823300034061FreshwaterMTATYATAADFTNWAERAKSMTVAELLYTVNDCHQAAESMRGWNPIKEGFYMDQASTYGMELNRR
Ga0334995_0036977_2439_26453300034062FreshwaterMATEHATAEQFTTWAARAKEMTVAALLYTVNDCREAAEAMRGWNPVKEGYYMDQLSTYRQELDRRRAA
Ga0334995_0095373_1456_16683300034062FreshwaterMTATSYATPADFTAWEAKAKTMTVAELLFTVKDCQQAEAAMRGWNPIKEGFYSDQACTYGMELTRRRRAA
Ga0335000_0005992_5649_58613300034063FreshwaterMRPEYATPADFTAWEAKAKSMTVAELLYMVKDCQQAEAAMRGWNPVKEGFYSDQASTYGMELTRRARVAA
Ga0335028_0114846_1491_17063300034071FreshwaterMAYLSPTQGYATAEDFTRWSEQAAKMTVAQLHYAAQDCRKAEQAMRGWNPVREGYYSDQACTFGDELRRRR
Ga0310130_0088214_733_9273300034073Fracking WaterTATYATAADFTNWAERAKSMTVAELLYTVNDCHQAAESMRGWNPIKEGFYMDQASTYGMELNRR
Ga0335029_0542081_189_3953300034102FreshwaterMATEHATAEQFTTWAARAKGMTVAALLYTVNDCREAAEAMRGWNPVKEGFYMDQLSAYRQELDRRRAA
Ga0335036_0023861_2553_27593300034106FreshwaterMKATQGYATAEDFARWSEQAAKMTVAQLHYAAQDCRKAEIAMRRWNPVREGYYSDQACTFGDELRRRR
Ga0335051_0178359_458_6703300034109FreshwaterMRPEYATPADFTAWEAKAKSMTVAELLYTVKDCQQAEAAMRGWNPVKEGFYSDQASTYGMELTRRARVAA
Ga0335063_0005858_3475_36963300034111FreshwaterMAYLSPTQGYATAEDFTRWSEQAAKMTIAQLHYAAQDCRKAEIAMRGWNPAREGYYSDQACTFGDELRRRRLV
Ga0335063_0020098_3322_35373300034111FreshwaterMAYLSPTQGYATAEDFTRWSEQAEKMTIAQLHYAAQDCRKAEQAMRGWNPVREGFYSDQACTFGDELRRRR
Ga0335063_0187827_1_2133300034111FreshwaterLSATQGYATAEDFARWSEQASKMTDEQLLFAAQDCRKAEQAMRGWNPVREGYYSDQASTFGDELRRRRLV
Ga0335007_0160259_359_5683300034283FreshwaterMIQEYATAADFTRWREQAERMSIAELYYAAADCRQAEYAMRGWNPVREGYYSDQACTFGDEIRRRNPAR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.