NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066585

Metagenome / Metatranscriptome Family F066585

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066585
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 42 residues
Representative Sequence MNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLK
Number of Associated Samples 96
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 92.06 %
% of genes near scaffold ends (potentially truncated) 99.21 %
% of genes from short scaffolds (< 2000 bps) 97.62 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (48.413 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(25.397 % of family members)
Environment Ontology (ENVO) Unclassified
(57.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(60.317 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.29%    β-sheet: 0.00%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF13392HNH_3 7.94
PF00496SBP_bac_5 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02I0SXAAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300002408|B570J29032_109297509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300002835|B570J40625_100674015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300003412|JGI25912J50252_10109811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300004240|Ga0007787_10459491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300005581|Ga0049081_10129382All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300005581|Ga0049081_10152339All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia oxyphila846Open in IMG/M
3300005582|Ga0049080_10058561All Organisms → cellular organisms → Bacteria → Proteobacteria1326Open in IMG/M
3300005582|Ga0049080_10153127All Organisms → cellular organisms → Bacteria → Proteobacteria772Open in IMG/M
3300005662|Ga0078894_11251996All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300006802|Ga0070749_10582527All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300006917|Ga0075472_10658112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300007559|Ga0102828_1162691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300007636|Ga0102856_1068306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300007670|Ga0102862_1075420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300007670|Ga0102862_1108100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300007708|Ga0102859_1216237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300007862|Ga0105737_1094741All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300008116|Ga0114350_1136991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300008117|Ga0114351_1457884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300008258|Ga0114840_1075587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300008261|Ga0114336_1293007All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300008266|Ga0114363_1016543All Organisms → Viruses → Predicted Viral3323Open in IMG/M
3300008266|Ga0114363_1136583All Organisms → cellular organisms → Bacteria → Proteobacteria831Open in IMG/M
3300008448|Ga0114876_1180487All Organisms → cellular organisms → Bacteria → Proteobacteria735Open in IMG/M
3300008450|Ga0114880_1059129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1592Open in IMG/M
3300008450|Ga0114880_1063472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1519Open in IMG/M
3300008450|Ga0114880_1066235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1479Open in IMG/M
3300008450|Ga0114880_1086266All Organisms → cellular organisms → Bacteria → Proteobacteria1243Open in IMG/M
3300008450|Ga0114880_1111840All Organisms → cellular organisms → Bacteria → Proteobacteria1039Open in IMG/M
3300008996|Ga0102831_1068081All Organisms → cellular organisms → Bacteria → Proteobacteria1188Open in IMG/M
3300009039|Ga0105152_10475073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300009085|Ga0105103_10527208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300009158|Ga0114977_10561632All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia vietnamiensis619Open in IMG/M
3300009163|Ga0114970_10291197All Organisms → cellular organisms → Bacteria → Proteobacteria932Open in IMG/M
3300009165|Ga0105102_10453639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia689Open in IMG/M
3300009168|Ga0105104_10152517All Organisms → cellular organisms → Bacteria → Proteobacteria1250Open in IMG/M
3300009169|Ga0105097_10388624All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300009183|Ga0114974_10217009All Organisms → cellular organisms → Bacteria → Proteobacteria1160Open in IMG/M
3300009184|Ga0114976_10164486All Organisms → Viruses → Predicted Viral1236Open in IMG/M
3300009194|Ga0114983_1065854All Organisms → cellular organisms → Bacteria → Proteobacteria831Open in IMG/M
3300010160|Ga0114967_10198057All Organisms → cellular organisms → Bacteria → Proteobacteria1082Open in IMG/M
3300010160|Ga0114967_10628965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300010368|Ga0129324_10165756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage912Open in IMG/M
3300011011|Ga0139556_1012736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1210Open in IMG/M
3300012006|Ga0119955_1176965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300012012|Ga0153799_1094828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300012017|Ga0153801_1061304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300017701|Ga0181364_1015095All Organisms → cellular organisms → Bacteria → Proteobacteria1288Open in IMG/M
3300017716|Ga0181350_1056416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1032Open in IMG/M
3300017722|Ga0181347_1179606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300017736|Ga0181365_1112741All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300017736|Ga0181365_1113179All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae653Open in IMG/M
3300017736|Ga0181365_1153851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300017747|Ga0181352_1071785All Organisms → cellular organisms → Bacteria → Proteobacteria977Open in IMG/M
3300017754|Ga0181344_1208025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300017761|Ga0181356_1120889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300017761|Ga0181356_1182575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300017774|Ga0181358_1274441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300017777|Ga0181357_1061036All Organisms → cellular organisms → Bacteria → Proteobacteria1459Open in IMG/M
3300017777|Ga0181357_1086017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1201Open in IMG/M
3300017777|Ga0181357_1148290All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae866Open in IMG/M
3300017777|Ga0181357_1174358All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae780Open in IMG/M
3300017784|Ga0181348_1236615All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300017785|Ga0181355_1278645All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300017785|Ga0181355_1377410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300019784|Ga0181359_1082763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1200Open in IMG/M
3300019784|Ga0181359_1120599All Organisms → cellular organisms → Bacteria → Proteobacteria938Open in IMG/M
3300019784|Ga0181359_1184499All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300019784|Ga0181359_1204776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300019784|Ga0181359_1228718All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300019784|Ga0181359_1245282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300020048|Ga0207193_1101164All Organisms → Viruses → Predicted Viral2624Open in IMG/M
3300021962|Ga0222713_10142908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1660Open in IMG/M
3300021962|Ga0222713_10264825All Organisms → Viruses → Predicted Viral1113Open in IMG/M
3300021963|Ga0222712_10206425All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300022543|Ga0212119_1082983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300024346|Ga0244775_11228761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300024352|Ga0255142_1038970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300025896|Ga0208916_10521356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300026573|Ga0255269_1055258All Organisms → cellular organisms → Bacteria → Proteobacteria1102Open in IMG/M
3300027152|Ga0255100_1045862All Organisms → cellular organisms → Bacteria → Proteobacteria841Open in IMG/M
3300027214|Ga0208306_1055427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300027320|Ga0208923_1037771All Organisms → cellular organisms → Bacteria → Proteobacteria861Open in IMG/M
3300027396|Ga0255146_1027872All Organisms → cellular organisms → Bacteria → Proteobacteria1201Open in IMG/M
3300027486|Ga0255086_1037468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300027579|Ga0255068_131344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300027586|Ga0208966_1172633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300027586|Ga0208966_1202755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300027608|Ga0208974_1089426All Organisms → cellular organisms → Bacteria → Proteobacteria833Open in IMG/M
3300027608|Ga0208974_1182893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300027659|Ga0208975_1094089All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales876Open in IMG/M
3300027659|Ga0208975_1136067All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales693Open in IMG/M
3300027679|Ga0209769_1036807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1680Open in IMG/M
3300027764|Ga0209134_10219006All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300027772|Ga0209768_10357613All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300027798|Ga0209353_10200787All Organisms → cellular organisms → Bacteria → Proteobacteria873Open in IMG/M
3300027806|Ga0209985_10412231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300027897|Ga0209254_10609986All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300027899|Ga0209668_10890380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300028394|Ga0304730_1091891All Organisms → cellular organisms → Bacteria → Proteobacteria1339Open in IMG/M
3300031707|Ga0315291_10748661All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300031746|Ga0315293_10574501All Organisms → cellular organisms → Bacteria → Proteobacteria858Open in IMG/M
3300031772|Ga0315288_10524718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1162Open in IMG/M
3300031784|Ga0315899_10550221All Organisms → cellular organisms → Bacteria → Proteobacteria1097Open in IMG/M
3300031784|Ga0315899_11083305All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales704Open in IMG/M
3300031787|Ga0315900_10942798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300031857|Ga0315909_10490717All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300031857|Ga0315909_10781043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300031951|Ga0315904_10256110All Organisms → cellular organisms → Bacteria → Proteobacteria1672Open in IMG/M
3300032050|Ga0315906_10458802All Organisms → cellular organisms → Bacteria → Proteobacteria1090Open in IMG/M
3300032050|Ga0315906_11285231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300032116|Ga0315903_10320031All Organisms → cellular organisms → Bacteria → Proteobacteria1300Open in IMG/M
3300032116|Ga0315903_10712737All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300032163|Ga0315281_11391831All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales692Open in IMG/M
3300032173|Ga0315268_11017060All Organisms → cellular organisms → Bacteria → Proteobacteria835Open in IMG/M
3300032516|Ga0315273_12236483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300032516|Ga0315273_13042769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300033995|Ga0335003_0227471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage876Open in IMG/M
3300034012|Ga0334986_0628380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300034068|Ga0334990_0403691All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales736Open in IMG/M
3300034104|Ga0335031_0340626All Organisms → cellular organisms → Bacteria → Proteobacteria961Open in IMG/M
3300034105|Ga0335035_0295307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage958Open in IMG/M
3300034106|Ga0335036_0372013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300034122|Ga0335060_0049455All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2659Open in IMG/M
3300034283|Ga0335007_0413492All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae839Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake25.40%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic7.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.35%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.56%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.56%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.76%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.17%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.38%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.59%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.79%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.79%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.79%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.79%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.79%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.79%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003412Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DDEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022543Indian_combined assemblyEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027152Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300027214Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027486Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027579Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_138705702035265000FreshwaterMSNYIAVCTPARDQVHTNYCYCMVNLVAYHTLNTEDAI
B570J29032_10929750913300002408FreshwaterMNYIAVCTPARDMVHANYAFCMTNMVAYHTINTIDAVAL
B570J40625_10067401513300002835FreshwaterMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLMQGTIIQN
JGI25912J50252_1010981133300003412Freshwater LakeMKYIAVCTPARDMVHTMFTYDLVNMVAYHTLNTNDAVSLKI
Ga0007787_1045949113300004240Freshwater LakeMRNYIAVCTPARDQVHTNYTYCMVNLVAFHTLNTTDAISLKLMQGTII
Ga0049081_1012938233300005581Freshwater LenticMNYIAVCTPARDMVHTQYTYCMVNAVAYHTLNTTDAVSL
Ga0049081_1015233933300005581Freshwater LenticMTIIAVCTPARDMVHTQYTYCLVNMVAFHACNTDDRIDLKIMQGTLI
Ga0049080_1005856133300005582Freshwater LenticMKYIAVCTPARDMVHTNYTYCLVNMVAYHTLNTTDAVSLKILQGTLIQ
Ga0049080_1015312733300005582Freshwater LenticMTPNYIAVCTPARDMVHANYAFCITNMVAHHTINTTD
Ga0078894_1125199633300005662Freshwater LakeMKTNYIAVCTPARDMVHTMFTYDLVNLVCHHTLNTNDAISLKISEGT
Ga0070749_1058252733300006802AqueousMNYVAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAVS
Ga0075472_1065811213300006917AqueousMSEENINYIAVCTPARDMVHANYTFCLVNMVAFHTINT
Ga0102828_116269133300007559EstuarineMTIIAVCTPARDMVHTQYAYCLVNMVAYHACNTDDR
Ga0102856_106830633300007636EstuarineMSNYIAVCTPARDQVHTNYCYCMVNMVAYHTLNTEDAISLKLMQ
Ga0102862_107542033300007670EstuarineMTQNYIAVCTPARDMVHANFTFCMVNMVAYHTINT
Ga0102862_110810013300007670EstuarineMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLMQ
Ga0102859_121623733300007708EstuarineMNYIAVCTPARDQVHTNYTYCMVNLVAYHTLNTTDAISLKLMQ
Ga0105737_109474133300007862Estuary WaterMSNYIAVCTPARDQVHTNYCYCMVNMVAYHTLNTEDAISLKL
Ga0114350_113699113300008116Freshwater, PlanktonMKYIAVCTPARDMVHTQYTYCMVNAVAYHTLNTTDAVSLKILQGTL
Ga0114351_145788413300008117Freshwater, PlanktonMNYIAVCTPARDMVHTNYTYCMVNMVAYHTLNTTD
Ga0114840_107558713300008258Freshwater, PlanktonMNYVAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAVSLK
Ga0114336_129300713300008261Freshwater, PlanktonMTPNYIAVCTPARDMVHTMFTYDLVNMVCYHTLNTN
Ga0114363_101654363300008266Freshwater, PlanktonMNYIAVCTPARDMVHANYTYCLVNMVTYHTLNTTD
Ga0114363_113658313300008266Freshwater, PlanktonMSNYIAVCTPARDMVHTMYSYDLVNMVAYHTLNTNDAVSLKISQGTL
Ga0114876_118048733300008448Freshwater LakeMNYIAVCTPARDQVHTNYTYCMVNLVAYHTLNTTDAISLKLLQ
Ga0114880_105912913300008450Freshwater LakeMSNYIAVCTPARDMVHTMYSYDLVNMVAYHTLNTNDAVSLKISQGT
Ga0114880_106347213300008450Freshwater LakeMSEENINYIAVCTPARDMVHANYTFCLVNMVAYHTIN
Ga0114880_106623513300008450Freshwater LakeMTEQEVNYIAVCTPARDMVHANYTFCLVNMVAYHTINTPDAVA
Ga0114880_108626613300008450Freshwater LakeMTPNYIAVCTPARDMVHANYAFCITNMVAHHTINTTDAVSLKIMQGTL
Ga0114880_111184013300008450Freshwater LakeMSEENINYIAVCTPARDMVHANYTFCLVNMVAYHTINTPDAVA
Ga0102831_106808113300008996EstuarineMTPNYIAVCTPARDMVHANFTFCMVNMVAYHTINTT
Ga0105152_1047507323300009039Lake SedimentMNNYIAVCTPARDMVHANFTYCLVNMVCYHTLNTTDAVSLKIMQGTLIQN
Ga0105103_1052720823300009085Freshwater SedimentMSNYIAVCTPARDQVHTNYCYCMVNLVAWHTLNTEDAISLKLM
Ga0114977_1056163213300009158Freshwater LakeMKYIAVATPARDMVHTMFAYDLVNMTAYHTLNTNDAI
Ga0114970_1029119733300009163Freshwater LakeMTQNYIAVCTPARDMVHANFTFCMVNMVAYHTINTTDAVSLKIMQG
Ga0105102_1045363933300009165Freshwater SedimentMNYIAVCTPARDMVHTNYTYCMVNLVAYHTLNTTDAVSLKILQG
Ga0105104_1015251733300009168Freshwater SedimentMNYIAVCTPARDQVHTQYTYCLVNMVAYHTLNTTDAVSLKIL
Ga0105097_1038862433300009169Freshwater SedimentMNYIAVCTPARDQVHTNYCYCMVNLVAYHTLNTEDAISLKLMQG
Ga0114974_1021700933300009183Freshwater LakeMTPNYIAVCTPARDMVHANFTFCMVNMVAHHTINTTD
Ga0114976_1016448613300009184Freshwater LakeMTIIAVCTPARDMVHTQYAYCLVNMVAFHACNTDDRIDLKIMQ
Ga0114983_106585413300009194Deep SubsurfaceMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLMQGT
Ga0114967_1019805713300010160Freshwater LakeMTPNYIAVCTPARDMVHANFTFCMVNMVAHHTINTTDAVS
Ga0114967_1062896523300010160Freshwater LakeMNVVAVCTPARDMVHTQYAYCLVNMVAYHVCSTEDRIDLKIMQGT
Ga0129324_1016575633300010368Freshwater To Marine Saline GradientMTIIAVCTPARDMVHTQYAYCLVNMVAYHACNTDDRIDLKIMQG
Ga0139556_101273633300011011FreshwaterMTQNYIAVCTPARDMVHANFTFCMVNMVAYHTINTTDA
Ga0119955_117696523300012006FreshwaterMNYVAVCTPARDMVHTNFTYCLVNMVAYHTISTTDAVSLKIMQGTLIQN
Ga0153799_109482813300012012FreshwaterMKTNYIAVCTPARDMVHTMFTYDLVNMVCYHTLNTNDAV
Ga0153801_106130413300012017FreshwaterMNYIAVCTPARDQVHTNYTYCLVNMVAYHTLNTTDAISLKLM
Ga0181364_101509533300017701Freshwater LakeMNYIAVCTPARDMVHTMYSYDLVNMVAYHTINTNDAVSLKIS
Ga0181350_105641613300017716Freshwater LakeMNNYIAVCTPARDMVHANFTYCLVNMVCYHTLNTTDAVSLKIMQGTL
Ga0181347_117960613300017722Freshwater LakeMNYIAVCTPARDMVHTMYSYDLVNMVAYHTINTNDAVSL
Ga0181365_111274133300017736Freshwater LakeMNYIAVCTPARDMVHTMYSYDLVNMVAYHTLPYYSF
Ga0181365_111317933300017736Freshwater LakeMKYIAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAVSLKILQGTLIQ
Ga0181365_115385113300017736Freshwater LakeMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKMLQGTFF
Ga0181352_107178533300017747Freshwater LakeMETSGRSMKYIAVCTPARDMVHTQYTYCMVNAVAYHTLNTTDAVSLKLLQGTLI
Ga0181344_120802513300017754Freshwater LakeMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTEDAISLKLMQGTII
Ga0181356_112088913300017761Freshwater LakeLETLVNKESMNYIAVCTPARDMVHTMYSYDLVNMVAYHT
Ga0181356_118257533300017761Freshwater LakeMSNYIAVCTPARDMVHANFTYCLVNMVCYHTLNTTDAVSLKIMQGTLIQN
Ga0181358_127444123300017774Freshwater LakeMNNYIAVCTPARDMVHANFTYCLVNMVCYHTLNTTDAVSLKIM
Ga0181357_106103633300017777Freshwater LakeMNYIAVCTPARDMVHTMYSYDLVNMVAYHTINTNDAVSLK
Ga0181357_108601743300017777Freshwater LakeMNYIAVCTPARDMVHTMYSYDLVNMVAYHKINTNDAVSIKISQ
Ga0181357_114829033300017777Freshwater LakeMTIIAVCTPARDMVHTQYAYCLVNMVAFHACNTDDRIDLKIMQGTLIQNQR
Ga0181357_117435833300017777Freshwater LakeMKYIAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAV
Ga0181348_123661533300017784Freshwater LakeMKYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAVSLKI
Ga0181355_127864533300017785Freshwater LakeMNNYIAVCTPARDMVHANYTFCMVNMVTYHTLNTTDA
Ga0181355_137741013300017785Freshwater LakeMNYVAVCTPARDMVHTNFTYCLVNMVAYHTINTTDAVSLKIMQG
Ga0181359_108276333300019784Freshwater LakeMTIIAVCTPARDMVHTQYAYCLVNMVAYHACNTDDRIDLKIM
Ga0181359_112059933300019784Freshwater LakeMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLLQGTLI
Ga0181359_118449913300019784Freshwater LakeMTPNYIAVCTPARDMVHANFTFCMVNMVAHHTINTTDAVSLKIMQGTLI
Ga0181359_120477633300019784Freshwater LakeMKYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAVSLKILQGT
Ga0181359_122871833300019784Freshwater LakeMTQNYIAVCTPARDMVHANYAFCMTNMVAYHTINTTD
Ga0181359_124528213300019784Freshwater LakeMNYVAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAVSLKILQGTLIQNQ
Ga0207193_110116453300020048Freshwater Lake SedimentMNYIAVCTPARDMVHANYTYCMVNMVAYHTLNTTDAIALKIMQGTLIQNQ
Ga0222713_1014290843300021962Estuarine WaterMNYIAVCTPARDQVHTNYTYCMVNMVAYDTLNTTDAISLKLMQG
Ga0222713_1026482533300021962Estuarine WaterMNYVAVCTPARDMVHTNFTYCLVNMVAYHTISTTDA
Ga0222712_1020642513300021963Estuarine WaterMTPNYIAVCTPARDMVHTMFTYDLVNMVCFHTLNTNDAVSLKISE
Ga0212119_108298323300022543FreshwaterMNYIAVCTPARDQVHTQYTYCMVNMVAYHTLNTTDAVSLKILQGTLIQN
Ga0244775_1122876113300024346EstuarineMSNYVAVCTPARDQVHTNYCYCMVNMVAYHTLNTEDAISLKLMQGTI
Ga0255142_103897033300024352FreshwaterMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISL
Ga0208916_1052135613300025896AqueousMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLLQGT
Ga0255269_105525833300026573FreshwaterMKANYIAVCTPARDMVHTMFTYDLVNMVCFHTLNTNDAISLKISEGT
Ga0255100_104586213300027152FreshwaterMNYIAVCTPARDQVHTNYTYCMVNLVAYHTLNTTDAISLK
Ga0208306_105542733300027214EstuarineMTQNYIAVCTPARDMVHANFTFCMVNMVAYHTINTT
Ga0208923_103777113300027320EstuarineMNYIAVCTPARDMVHANYTYCMVNMVAYHTLNTTDAIAL
Ga0255146_102787233300027396FreshwaterMKYIAVCTPARDMVHTQYTYCMVNLVAYHTLNTTDAVSLKILQG
Ga0255086_103746813300027486FreshwaterMNYIAVCTPARDQVHTNYTYCMVNLVAYHTLNTTDAISLKLMQG
Ga0255068_13134413300027579FreshwaterMNYIAVCTPARDQVHTNYTYCMVNLVAYHTLNTTDA
Ga0208966_117263313300027586Freshwater LenticMTQNYIAVCTPARDMVHANYAFCMTNMVAYHTINTTDAVSLKIMQGTLI
Ga0208966_120275523300027586Freshwater LenticMTIIAVCTPARDMVHTQYAYCLVNMVAYHACNTDDRIDLKIMQGT
Ga0208974_108942633300027608Freshwater LenticMKYIAVCTPARDMVHTNYTYCLVNMVAYHTLNTTDAVS
Ga0208974_118289313300027608Freshwater LenticMNYIAVCTPARDMVHTMYSYDLVNMVAYHTLNTNDAVSLKISQGTLI
Ga0208975_109408933300027659Freshwater LenticMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLMQG
Ga0208975_113606713300027659Freshwater LenticMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAI
Ga0209769_103680743300027679Freshwater LakeMNYIAVCTPARDMVHANYTYCMVNMVAYHTLNTTDAIALKI
Ga0209134_1021900613300027764Freshwater LakeMNYIAVCTPARDMVHTMYSYDLVNMVAYHTLNTND
Ga0209768_1035761313300027772Freshwater LakeMSNYIAVCTPARDMVHTMYSYDLVNMVAYHTLNTNDAVSL
Ga0209353_1020078733300027798Freshwater LakeMNYVAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAV
Ga0209985_1041223133300027806Freshwater LakeMKHNYIAVCTPARDMVHTMFTYDLVNMVCFHTLNTNDAISLK
Ga0209254_1060998613300027897Freshwater Lake SedimentMNYIAVCTPARDQVHTNYTYCMVNMVAFHTLNTEDAISLKLMQGTII
Ga0209668_1089038033300027899Freshwater Lake SedimentMNYIAVCTPARDMVHTMYSYDLVNMVAYHTINTEDAV
Ga0304730_109189133300028394Freshwater LakeMNYIAVCTPARDMVHTNYTYCMVNMVSYHTLNTTDAISLKIMQGTIIQNQR
Ga0315291_1074866133300031707SedimentMNYVAVCTPARDMVHTNFTYCLVNMVAYHTINTTDAVS
Ga0315293_1057450133300031746SedimentMNYVAVCTPARDMVHTNFTYCLVNMVAYHTINTTDAVSLKIMQ
Ga0315288_1052471813300031772SedimentMIIAVCTPARDMVHTQYAYCLVNMVAYHACNTDDRIDLKIMQGTLIQ
Ga0315899_1055022133300031784FreshwaterMNYIAVCTPARDMVHTQYTYCMVNAVAYHTLNTTDAVSLKILQ
Ga0315899_1108330533300031784FreshwaterMKYIAVCTPARDMVHTNYTYCMVNMVAYHTLNTTDAVSLK
Ga0315900_1094279833300031787FreshwaterMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLLQ
Ga0315909_1049071713300031857FreshwaterMSEENINYIAVCTPARDMVHANYTFCLVNMVAYHTINTPDAVALKIN
Ga0315909_1078104313300031857FreshwaterMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLKLMQGTIIQ
Ga0315904_1025611043300031951FreshwaterMSEENINYIAVCTPARDMVHANYTFCLVNMVAYHTINTMDAVALKIN
Ga0315906_1045880213300032050FreshwaterMNYIAVCTPARDMVHTMYSYNLVNMVAYHTINTNDAVSLKISQ
Ga0315906_1128523123300032050FreshwaterMNYIAVCTPARDMVHTMYSYDLVNMVAYHTINTNDAVSLKISQGTLIANQR
Ga0315903_1032003113300032116FreshwaterMSEENINYIAVCTPARDMVHANYTFCLVNMVAYHTINTPDAVALKINQGTLI
Ga0315903_1071273733300032116FreshwaterMKYIAVCTPARDMVHTMFTYDLVNMVAYHTLNTNDAVILKISQGT
Ga0315281_1139183133300032163SedimentMTQNYIAVCTPARDMVHANFTFCMVNMVAYHTINTTDAVSLKI
Ga0315268_1101706013300032173SedimentMTPNYIAVCTPARDMVHANYAFCITNMVAHHTINTTDAVS
Ga0315273_1223648333300032516SedimentMNYVAVCTPARDMVHTNFTYCLVNMVAYHTINTTDAVSLKIM
Ga0315273_1304276913300032516SedimentMTQNYIAVCTPARDMVHANYAFCITNMVAYHTINTTDAV
Ga0335003_0227471_756_8753300033995FreshwaterMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAISLK
Ga0334986_0628380_401_5083300034012FreshwaterMNYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDA
Ga0334990_0403691_625_7353300034068FreshwaterMKYIAVCTPARDQVHTNYTYCMVNMVAYHTLNTTDAV
Ga0335031_0340626_837_9593300034104FreshwaterMSNYIAVCTPARDQVHTNYCYCMVNMVAYHTLNTEDAISLK
Ga0335035_0295307_3_1433300034105FreshwaterMTIIAVCTPARDMVHTQYAYCLVNMVAYHACNTDDRIDLKIMQGTLI
Ga0335036_0372013_3_1223300034106FreshwaterMSNYIAVCTPARDQVHTNYCYCMVNMVAYHTLNTEDAISL
Ga0335060_0049455_2554_26583300034122FreshwaterMTIIAVCTPARDMVHTQYAYCLVNMVAFHACNTDD
Ga0335007_0413492_3_1373300034283FreshwaterMNYIAVCTPARDQVHTNYTYCMVNLVAYHTLNTTDAISLKLMQGT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.