NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F066673

Metagenome Family F066673

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066673
Family Type Metagenome
Number of Sequences 126
Average Sequence Length 41 residues
Representative Sequence LTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL
Number of Associated Samples 92
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.79 %
% of genes near scaffold ends (potentially truncated) 99.21 %
% of genes from short scaffolds (< 2000 bps) 84.92 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.413 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(27.778 % of family members)
Environment Ontology (ENVO) Unclassified
(51.587 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(59.524 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.85%    β-sheet: 0.00%    Coil/Unstructured: 70.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF03772Competence 36.51
PF01642MM_CoA_mutase 3.17
PF00316FBPase 2.38
PF14378PAP2_3 1.59
PF00756Esterase 0.79
PF13495Phage_int_SAM_4 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0658DNA uptake channel protein ComEC, N-terminal domainIntracellular trafficking, secretion, and vesicular transport [U] 36.51
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 3.17
COG0158Fructose-1,6-bisphosphataseCarbohydrate transport and metabolism [G] 2.38

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.41 %
UnclassifiedrootN/A1.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005166|Ga0066674_10445480All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005167|Ga0066672_10200377All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1272Open in IMG/M
3300005172|Ga0066683_10109634All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300005172|Ga0066683_10146408All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1449Open in IMG/M
3300005172|Ga0066683_10264510All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1067Open in IMG/M
3300005172|Ga0066683_10430407All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium812Open in IMG/M
3300005174|Ga0066680_10105680All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300005180|Ga0066685_10106926All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300005181|Ga0066678_10484444All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium822Open in IMG/M
3300005181|Ga0066678_10621448All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium719Open in IMG/M
3300005181|Ga0066678_11072918All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005184|Ga0066671_10699017All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005445|Ga0070708_100524262All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005450|Ga0066682_10464620All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium803Open in IMG/M
3300005450|Ga0066682_10550603All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005530|Ga0070679_100956133All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005545|Ga0070695_100871722All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005549|Ga0070704_101241506All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium680Open in IMG/M
3300005553|Ga0066695_10701298All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium593Open in IMG/M
3300005556|Ga0066707_10190769All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1318Open in IMG/M
3300005556|Ga0066707_10221238All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300005557|Ga0066704_10634899All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium681Open in IMG/M
3300006046|Ga0066652_100608336All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1031Open in IMG/M
3300006755|Ga0079222_10987190All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium721Open in IMG/M
3300006791|Ga0066653_10152358All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1127Open in IMG/M
3300006791|Ga0066653_10413152All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium690Open in IMG/M
3300006791|Ga0066653_10431293All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium673Open in IMG/M
3300006796|Ga0066665_10851230All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium712Open in IMG/M
3300006796|Ga0066665_11032114All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006797|Ga0066659_10013707All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4446Open in IMG/M
3300006797|Ga0066659_10045744All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2733Open in IMG/M
3300006797|Ga0066659_11314349All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium603Open in IMG/M
3300006845|Ga0075421_100149174All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2922Open in IMG/M
3300006847|Ga0075431_100373647All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1430Open in IMG/M
3300006852|Ga0075433_10270214All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1507Open in IMG/M
3300006854|Ga0075425_100044289All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4972Open in IMG/M
3300006854|Ga0075425_102318547All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006854|Ga0075425_102396009All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium586Open in IMG/M
3300006871|Ga0075434_102307961All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium541Open in IMG/M
3300006914|Ga0075436_100119057All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1846Open in IMG/M
3300006914|Ga0075436_100323776All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300007004|Ga0079218_13597803All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300009012|Ga0066710_100966971All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1313Open in IMG/M
3300009012|Ga0066710_102761808All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium697Open in IMG/M
3300009012|Ga0066710_103002628All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium657Open in IMG/M
3300009012|Ga0066710_103033696All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium652Open in IMG/M
3300009012|Ga0066710_104387749All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium527Open in IMG/M
3300009038|Ga0099829_11487880All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium559Open in IMG/M
3300009089|Ga0099828_10084479All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2717Open in IMG/M
3300009089|Ga0099828_10995801All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium747Open in IMG/M
3300009090|Ga0099827_10262602All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1454Open in IMG/M
3300009137|Ga0066709_102538093All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium689Open in IMG/M
3300009147|Ga0114129_12362098All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium637Open in IMG/M
3300009156|Ga0111538_11211446All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300009162|Ga0075423_11840225All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300009597|Ga0105259_1188315All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300010303|Ga0134082_10013722All Organisms → cellular organisms → Bacteria2939Open in IMG/M
3300010303|Ga0134082_10360548All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium617Open in IMG/M
3300010304|Ga0134088_10303900All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium771Open in IMG/M
3300010304|Ga0134088_10307954All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300010323|Ga0134086_10280291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium642Open in IMG/M
3300010323|Ga0134086_10421488All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300010325|Ga0134064_10132498All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium848Open in IMG/M
3300010333|Ga0134080_10700837All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium502Open in IMG/M
3300010335|Ga0134063_10612525All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium555Open in IMG/M
3300011270|Ga0137391_10085094All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2731Open in IMG/M
3300012200|Ga0137382_10107483All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300012203|Ga0137399_10008358All Organisms → cellular organisms → Bacteria6018Open in IMG/M
3300012203|Ga0137399_10114935All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300012203|Ga0137399_10511584All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300012203|Ga0137399_11673834All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012228|Ga0137459_1197031All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium589Open in IMG/M
3300012349|Ga0137387_10568553All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium822Open in IMG/M
3300012349|Ga0137387_11258161All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012351|Ga0137386_10645138All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium762Open in IMG/M
3300012354|Ga0137366_10066805All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas2742Open in IMG/M
3300012356|Ga0137371_11381453All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium517Open in IMG/M
3300012896|Ga0157303_10031351All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300012922|Ga0137394_10528988All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1000Open in IMG/M
3300012922|Ga0137394_11229726All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium612Open in IMG/M
3300012925|Ga0137419_10349320All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1144Open in IMG/M
3300012929|Ga0137404_11862780All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium560Open in IMG/M
3300012930|Ga0137407_11592688All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012931|Ga0153915_10473437All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1429Open in IMG/M
3300012972|Ga0134077_10199910All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium814Open in IMG/M
3300012975|Ga0134110_10213786All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium812Open in IMG/M
3300012976|Ga0134076_10281434All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium716Open in IMG/M
3300012977|Ga0134087_10548285All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium590Open in IMG/M
3300015245|Ga0137409_10147809All Organisms → cellular organisms → Bacteria2151Open in IMG/M
3300015358|Ga0134089_10161215All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium889Open in IMG/M
3300015358|Ga0134089_10519948All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium524Open in IMG/M
3300017654|Ga0134069_1269979All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium596Open in IMG/M
3300017657|Ga0134074_1017632All Organisms → cellular organisms → Bacteria2341Open in IMG/M
3300017657|Ga0134074_1161117All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium787Open in IMG/M
3300017659|Ga0134083_10269235All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium717Open in IMG/M
3300018063|Ga0184637_10615556Not Available611Open in IMG/M
3300018431|Ga0066655_10005834All Organisms → cellular organisms → Bacteria5041Open in IMG/M
3300018431|Ga0066655_10085955All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1726Open in IMG/M
3300018431|Ga0066655_10393458All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium914Open in IMG/M
3300018468|Ga0066662_10223604All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1512Open in IMG/M
3300018482|Ga0066669_11747965All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium573Open in IMG/M
3300020170|Ga0179594_10293124All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium616Open in IMG/M
3300024178|Ga0247694_1043633All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_69_5508Open in IMG/M
3300025885|Ga0207653_10393911All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium543Open in IMG/M
3300025910|Ga0207684_11165513All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium639Open in IMG/M
3300026307|Ga0209469_1017462All Organisms → cellular organisms → Bacteria2567Open in IMG/M
3300026327|Ga0209266_1018921All Organisms → cellular organisms → Bacteria3849Open in IMG/M
3300026343|Ga0209159_1006366All Organisms → cellular organisms → Bacteria7415Open in IMG/M
3300026536|Ga0209058_1239298All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium652Open in IMG/M
3300026540|Ga0209376_1009868All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis7162Open in IMG/M
3300026540|Ga0209376_1051838All Organisms → cellular organisms → Bacteria2356Open in IMG/M
3300026547|Ga0209156_10322846All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium688Open in IMG/M
3300026547|Ga0209156_10382442All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium594Open in IMG/M
3300027273|Ga0209886_1063657All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium585Open in IMG/M
3300027787|Ga0209074_10148250All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium842Open in IMG/M
3300028072|Ga0247675_1006037All Organisms → cellular organisms → Bacteria1649Open in IMG/M
3300028715|Ga0307313_10270824All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300028796|Ga0307287_10185343All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300028807|Ga0307305_10328144All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300030620|Ga0302046_10832979All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium741Open in IMG/M
3300031547|Ga0310887_11138998Not Available502Open in IMG/M
3300031965|Ga0326597_11582404All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium625Open in IMG/M
3300032180|Ga0307471_103099546All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium589Open in IMG/M
3300032828|Ga0335080_10708555All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300032829|Ga0335070_11786709All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium556Open in IMG/M
3300032955|Ga0335076_10067994All Organisms → cellular organisms → Bacteria3510Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil27.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil15.08%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.38%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.38%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.59%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.79%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027273Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066674_1044548013300005166SoilPHYVSTRQGEILTALSLGSAGEMARLDVALLEGFHKVALAPRCGAKPIQL*
Ga0066672_1020037723300005167SoilHQGEVLTELSLASDQERAKLDVVLLEGFRKVGLAPRCGAKPVQPV*
Ga0066683_1010963413300005172SoilEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL*
Ga0066683_1014640813300005172SoilQGEVLTELRLDSDQEKARLDVALLDGFRKVGLAPRCGAKPLQLM*
Ga0066683_1026451013300005172SoilTPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI*
Ga0066683_1043040723300005172SoilEVLTELNLDTDQERAKLDVILLEGLRKVALAPRCGAKSVQLM*
Ga0066680_1010568013300005174SoilVLTELSLTSDQERAKLDVVLLEGFRKVALAPRCGAKPVQLL*
Ga0066685_1010692623300005180SoilVELRLDSDQEKAKLDVALLDAFRRVGLAPRCGARSVQLL*
Ga0066678_1048444413300005181SoilLTELNLDTDQERAKLDVILLEGLCKVALAPRCGAKPVQLM*
Ga0066678_1062144823300005181SoilVLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM*
Ga0066678_1107291823300005181SoilLTELSLGSDQEKARLDVALVEGIRKVALAPRCGAKPTQL*
Ga0066671_1069901713300005184SoilGEILTELSLASDQEKAKLDVGLLEGFRKVALAPRCGAKPAQL*
Ga0070708_10052426213300005445Corn, Switchgrass And Miscanthus RhizosphereEILTELSLASDQEKAKLDVALLEGFRKVALAPRCGAKPSQL*
Ga0066682_1046462013300005450SoilEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI*
Ga0066682_1055060323300005450SoilLTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL*
Ga0070679_10095613323300005530Corn RhizosphereQGEILTELSLASDGEKAKLDVALLEGFRKVAIAPRCGAKPVQL*
Ga0070695_10087172223300005545Corn, Switchgrass And Miscanthus RhizosphereSTRQGEILTELSLQSDGEKARLDVALLEGFKRVALAPRCGAKPSQL*
Ga0070704_10124150613300005549Corn, Switchgrass And Miscanthus RhizosphereVSTRQGEILTELSLASDQEKARLDVTLLDGFRKVAAAPRCGAKPTHL*
Ga0066695_1070129823300005553SoilGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV*
Ga0066707_1019076923300005556SoilLVELRLDSDQEKAKLDVALLDAFRRVGLAPRCGARSVQLL*
Ga0066707_1022123823300005556SoilLDTDQEKAKLDVVLLEGFRKVAAAPRCGSKPVTL*
Ga0066704_1063489923300005557SoilLNLDTDQERAKLDVILLEGLCKVALAPRCGAKPVQLM*
Ga0066652_10060833613300006046SoilDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI*
Ga0079222_1098719023300006755Agricultural SoilQGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQLM*
Ga0066653_1015235813300006791SoilLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV*
Ga0066653_1041315223300006791SoilLTELSLEPDQERAKLDVVLLEGLRKVALAPRCGAKSVQLM*
Ga0066653_1043129313300006791SoilREGEVTTAINLDTDQEKAKLDVVLLEGFRKVAAAPRCGTKPVTL*
Ga0066665_1085123023300006796SoilGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI*
Ga0066665_1103211413300006796SoilQGEILTALSLGSAGEMARLDVALLEGFHKVALAPRCGAKPIQL*
Ga0066659_1001370713300006797SoilEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM*
Ga0066659_1004574433300006797SoilSTRHGEILTELSLARHQEKAKLDVALLEGFRKVALAPRCGAKPSQL*
Ga0066659_1131434913300006797SoilGEVLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM*
Ga0075421_10014917443300006845Populus RhizosphereLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL*
Ga0075431_10037364713300006847Populus RhizosphereQGEILTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL*
Ga0075433_1027021413300006852Populus RhizospherePQGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM*
Ga0075425_10004428943300006854Populus RhizospherePHYVSTRAGEILTGLTMGTDQETAKVTVILIEGFRRVALAPRCGAKPVTLA*
Ga0075425_10231854713300006854Populus RhizosphereLQSDQEKAKLDVALLEGFRKVAMAPRCGAKPIQL*
Ga0075425_10239600913300006854Populus RhizosphereSLGSDQERAKLSVVLIDGFRRVALTPRCGAKPVRLP*
Ga0075434_10230796123300006871Populus RhizosphereVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGAKSVQLL*
Ga0075436_10011905713300006914Populus RhizosphereGEVLVELRLDSDQEKAKLDVALLDGFRKVGLAPRCGARPVQLM*
Ga0075436_10032377623300006914Populus RhizosphereELSLGSDQEKAKLDVALVEGIRKVALAPRCGAKPTQL*
Ga0079218_1359780323300007004Agricultural SoilTSQGEVLVEVALSSDQSKATLDVVLMEALHKVAAAPRCGAKPVALP*
Ga0066710_10096697123300009012Grasslands SoilLSPHYVSTRQGEVLTELSLGSDQERAKLSVVLIDGFRRVGLTPRCGAKPMRLP
Ga0066710_10276180813300009012Grasslands SoilTELSLTSDQERAKLDVVLLEGFRKVALAPRCGAKPVQLV
Ga0066710_10300262813300009012Grasslands SoilNLESDQERAKLDVVLLEAFRKVGLAPRCGAKPVQLM
Ga0066710_10303369623300009012Grasslands SoilTPQGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM
Ga0066710_10438774923300009012Grasslands SoilELSLTSDQERAKLDVVLLEGLSKVGLAPRCGAKPVQLV
Ga0099829_1148788023300009038Vadose Zone SoilQGEVLTELSLGSDQERAKLSVVLIDGFRRIGLTPRCGAKPMRLP*
Ga0099828_1008447913300009089Vadose Zone SoilELSLSSDQEMAKLDVVLLEGFHKVAMAPRCGAKPVQLV*
Ga0099828_1099580123300009089Vadose Zone SoilHYVSTRQGEILTELSLSSDQEMAKLDVVLLEGFRKVGMAPRCGAKPVQLV*
Ga0099827_1026260213300009090Vadose Zone SoilVSTLQGEVLTEISLGSDQEKARLDVVLLEGFRRVALAPRCGAKSVQLM*
Ga0066709_10253809323300009137Grasslands SoilELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM*
Ga0114129_1236209823300009147Populus RhizosphereVSTRQGEILTELSLASDQEKAKLDVALLEGFGKVALAPRCGAKPVQL*
Ga0111538_1121144623300009156Populus RhizosphereTRQGEILTGLSLDSDGEKAKLDVVLFEGFHKVARAPRCGAKPTQL*
Ga0075423_1184022513300009162Populus RhizosphereLSLQSDGEKAKLDVALLEGFKRVALAPRCGAKPSQL*
Ga0105259_118831513300009597SoilTRQGEILTELRLASDQEKARLDVALLEGFRRVAAAPRCGAKPSQL*
Ga0134082_1001372213300010303Grasslands SoilTRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKAVQLM*
Ga0134082_1036054813300010303Grasslands SoilTRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKPVQLM*
Ga0134088_1030390013300010304Grasslands SoilPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI*
Ga0134088_1030795423300010304Grasslands SoilLTELSLSSDQEMAKLDVVLLEGFRKVAMAPRCGAKPVQLV*
Ga0134086_1028029123300010323Grasslands SoilSLASDQEKAKLDVALLEGFRKVALAPRCGAKPSQL*
Ga0134086_1042148823300010323Grasslands SoilLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM*
Ga0134064_1013249813300010325Grasslands SoilVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI*
Ga0134080_1070083713300010333Grasslands SoilLDTDQEKAKLDVVLLEGFRKVAAAPRCGTKPVTL*
Ga0134063_1061252523300010335Grasslands SoilSLTSDQERAKLDVVLLEGLSKVGLAPRCGAKPVQLV*
Ga0137391_1008509413300011270Vadose Zone SoilEILTELSLSSDQEMAKLDVVLLEGFRKVAMAPRCGAKPVQLV*
Ga0137382_1010748313300012200Vadose Zone SoilLGSAGEMARLDVALLEGFHKVALAPRCGAKPIQL*
Ga0137399_1000835813300012203Vadose Zone SoilQGEILTELSLASDQEKAKLDVALLEGFRKVALAPRCGAKPSQL*
Ga0137399_1011493513300012203Vadose Zone SoilQGEILTELSLASDQEKAKLDVALLEGFRKVAAAPRCGAKPSQL*
Ga0137399_1051158423300012203Vadose Zone SoilVSTRQGEILTELTLASDQEKAKLDVALLEGFRKVSAAPRCGAKPTQL*
Ga0137399_1167383413300012203Vadose Zone SoilQGEILTELSLASDQEKAKLDVALLEGFRKVAAAPRCGAKPSAL*
Ga0137459_119703123300012228SoilLTELSLGSDQEKAKLDVALLEAFRKVGLAPRCGAKPVQLL*
Ga0137387_1056855323300012349Vadose Zone SoilELRLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV*
Ga0137387_1125816123300012349Vadose Zone SoilAGEILTGLSLASDQESAKLTVILIEGFRKVALAPRCGAKPTQL*
Ga0137386_1064513813300012351Vadose Zone SoilLDSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQLM*
Ga0137366_1006680533300012354Vadose Zone SoilTELRLDSDQERAKLDVALLDGFRRVGLAPRCGARSVQLM*
Ga0137371_1138145323300012356Vadose Zone SoilQTDQERAKLDVILLEAFRKVALAPRCGAQPVQLM*
Ga0157303_1003135113300012896SoilQGEILTELSLASDQEKARLDVTLLDGFRKVAAAPRCGAKPTHL*
Ga0137394_1052898823300012922Vadose Zone SoilTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL*
Ga0137394_1122972613300012922Vadose Zone SoilMTELSLGSDQEKAKLDVALLEAFRKVGLAPRCGAKSVQLI*
Ga0137419_1034932013300012925Vadose Zone SoilAPSYVSTPQGEVLVELRLDSDQEKARLDVALLEGFRKVALAPRCAAKPVQLM*
Ga0137404_1186278023300012929Vadose Zone SoilLDSDQEKAKLDVALLEGFRKVALAPRCAAKPVQLM*
Ga0137407_1159268813300012930Vadose Zone SoilILTELSLGSDGEKARLDVALIEGFHKVALAPRCGAKPTQL*
Ga0153915_1047343713300012931Freshwater WetlandsTPQGEVLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLL*
Ga0134077_1019991023300012972Grasslands SoilELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM*
Ga0134110_1021378613300012975Grasslands SoilQGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM*
Ga0134076_1028143413300012976Grasslands SoilVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVHLM*
Ga0134087_1054828523300012977Grasslands SoilLRLDSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQLI*
Ga0137409_1014780913300015245Vadose Zone SoilTRQGEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPSQL*
Ga0134089_1016121533300015358Grasslands SoilLTELRLDSDQEKAKLDVALLDGFRKVGLAPRCGARPVQLL*
Ga0134089_1051994823300015358Grasslands SoilVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM*
Ga0134069_126997923300017654Grasslands SoilLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM
Ga0134074_101763213300017657Grasslands SoilGEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL
Ga0134074_116111713300017657Grasslands SoilVSTPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCEAKPVQLI
Ga0134083_1026923523300017659Grasslands SoilVLTELRLDSDQEKARLDVALLDGFRKVGLAPRCGAKPLQLM
Ga0184637_1061555623300018063Groundwater SedimentLGTDQEMAKLTVVLIEGYRRVALTPRCGAKPVTLA
Ga0066655_1000583413300018431Grasslands SoilTRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKPVQLM
Ga0066655_1008595513300018431Grasslands SoilVLVELRLDSDQEKARLDVALLEGFRKVGLAPRCGARPVQLM
Ga0066655_1039345823300018431Grasslands SoilTELRLDSDQEKARLDVALLDGFRKVGLAPRCGAKPLQLM
Ga0066662_1022360423300018468Grasslands SoilGEVLTELRLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV
Ga0066669_1174796523300018482Grasslands SoilSLDTDQERARLDVVLLEAFRKVSLAPRCGALPAQLM
Ga0179594_1029312413300020170Vadose Zone SoilRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM
Ga0247694_104363313300024178SoilLTELSLGTDQQRAKLDVVLMEGFRKVAIAPRCGAKPAQLA
Ga0207653_1039391113300025885Corn, Switchgrass And Miscanthus RhizosphereVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARSVQLM
Ga0207684_1116551313300025910Corn, Switchgrass And Miscanthus RhizosphereSTRQGEILTELSLQSDGEKARLDVALLEGFKRVALAPRCGAKPSQL
Ga0209469_101746233300026307SoilSTRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKPVQLM
Ga0209266_101892143300026327SoilQGEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL
Ga0209159_100636613300026343SoilRLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV
Ga0209058_123929823300026536SoilEVLVELRLDSDQEKARLDVALLEGFRKVGLAPRCGARPVQLM
Ga0209376_100986863300026540SoilLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM
Ga0209376_105183823300026540SoilTPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI
Ga0209156_1032284613300026547SoilLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM
Ga0209156_1038244223300026547SoilVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM
Ga0209886_106365723300027273Groundwater SandQGEIHTELSLSTDQEKAKLDVVLLEGFRKIGLAPRCGAKPATVL
Ga0209074_1014825013300027787Agricultural SoilVLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGAKSVQLL
Ga0247675_100603713300028072SoilTGITMGTDQETAKLTVILIEGFRRVALAPRCGAKPVTLP
Ga0307313_1027082413300028715SoilEILTELSLGSDGEKAKLDVALVEAFRKVALAPRCGAKPTQL
Ga0307287_1018534323300028796SoilQGEILTELSLGSDGEKAKLDVALVEAFRKVALAPRCGARPTQL
Ga0307305_1032814423300028807SoilLTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL
Ga0302046_1083297923300030620SoilEISLSSDQEKARLDVVLMEGLRKVAFAPRCGAKPVNLA
Ga0310887_1113899813300031547SoilQGEILTEFSLASDQEKARLDVALLDGFRKVAAAPRCGAKPTHL
Ga0326597_1158240413300031965SoilLGTDQEMAKLTVVLIEGYRRVALAPRCGAKPVTLA
Ga0307471_10309954613300032180Hardwood Forest SoilRLDSDQEKAKLDVALLDGFRRVGLAPRCGAKSVQLL
Ga0335080_1070855523300032828SoilLSLSTDQARAKTDVVLMEGFRKVALAPRCGAAPVQLP
Ga0335070_1178670923300032829SoilGEVLTELSLGSDQEKAKLDVVLLEGFRKVALAPRCGAQPVQLL
Ga0335076_1006799433300032955SoilVLTGISLETDQEKAKLDVVLLEAFRKVALAPRCGARAVQLM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.