NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067734

Metagenome / Metatranscriptome Family F067734

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067734
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 50 residues
Representative Sequence MANTDKLLLICIIGMIIGFIIVIIDVQKTSYKKGVRDGYHRGRSIKGQE
Number of Associated Samples 83
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 79.20 %
% of genes near scaffold ends (potentially truncated) 23.20 %
% of genes from short scaffolds (< 2000 bps) 72.00 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (69.600 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(28.000 % of family members)
Environment Ontology (ENVO) Unclassified
(44.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(42.400 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.25%    β-sheet: 0.00%    Coil/Unstructured: 46.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF01844HNH 3.20
PF05869Dam 2.40
PF09250Prim-Pol 1.60
PF05065Phage_capsid 1.60
PF04860Phage_portal 1.60
PF12850Metallophos_2 0.80
PF16778Phage_tail_APC 0.80
PF02018CBM_4_9 0.80
PF13385Laminin_G_3 0.80
PF04586Peptidase_S78 0.80
PF14279HNH_5 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 1.60
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.40 %
UnclassifiedrootN/A1.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352004|2199905357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14006Open in IMG/M
3300002408|B570J29032_109255536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300002408|B570J29032_109330258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300002447|JGI24768J34885_10014381All Organisms → Viruses → Predicted Viral2615Open in IMG/M
3300002447|JGI24768J34885_10118409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300002835|B570J40625_100817093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
3300004112|Ga0065166_10109580All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300004154|Ga0066603_10403804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales638Open in IMG/M
3300004481|Ga0069718_15844300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300004481|Ga0069718_15844409All Organisms → cellular organisms → Bacteria2021Open in IMG/M
3300004481|Ga0069718_16087611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300005527|Ga0068876_10039745All Organisms → cellular organisms → Bacteria2904Open in IMG/M
3300005527|Ga0068876_10234401All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300005527|Ga0068876_10522829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300005528|Ga0068872_10724911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300006030|Ga0075470_10002006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6349Open in IMG/M
3300006484|Ga0070744_10074336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
3300006484|Ga0070744_10110719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300006639|Ga0079301_1110834All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300006802|Ga0070749_10109130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1631Open in IMG/M
3300006802|Ga0070749_10606921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300006805|Ga0075464_10225630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1117Open in IMG/M
3300006805|Ga0075464_10319359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage936Open in IMG/M
3300006920|Ga0070748_1088787All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300006920|Ga0070748_1194611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300006920|Ga0070748_1280910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300007162|Ga0079300_10099477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300007363|Ga0075458_10048242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1341Open in IMG/M
3300007363|Ga0075458_10245534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300007735|Ga0104988_10316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13412Open in IMG/M
3300008055|Ga0108970_10473630All Organisms → Viruses → Predicted Viral1854Open in IMG/M
3300008055|Ga0108970_11516351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300008107|Ga0114340_1043037All Organisms → Viruses → Predicted Viral2010Open in IMG/M
3300008261|Ga0114336_1028190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3149Open in IMG/M
3300008266|Ga0114363_1002710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15230Open in IMG/M
3300008266|Ga0114363_1248914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300009009|Ga0105105_10330026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300009009|Ga0105105_10916472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300009037|Ga0105093_10383580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300009037|Ga0105093_10411423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales739Open in IMG/M
3300009037|Ga0105093_10531896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage658Open in IMG/M
3300009081|Ga0105098_10051078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1686Open in IMG/M
3300009081|Ga0105098_10206297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300009081|Ga0105098_10784900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300009082|Ga0105099_10320803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage911Open in IMG/M
3300009082|Ga0105099_10883509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300009085|Ga0105103_10696206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300009165|Ga0105102_10614404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300009169|Ga0105097_10057199All Organisms → Viruses → Predicted Viral2106Open in IMG/M
3300009169|Ga0105097_10138007All Organisms → Viruses → Predicted Viral1339Open in IMG/M
3300009169|Ga0105097_10326886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300009169|Ga0105097_10395760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales767Open in IMG/M
3300009169|Ga0105097_10467121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300009169|Ga0105097_10491125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300010354|Ga0129333_10243366All Organisms → Viruses → Predicted Viral1624Open in IMG/M
3300010354|Ga0129333_11229416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300010354|Ga0129333_11337806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300010368|Ga0129324_10413518Not Available520Open in IMG/M
3300011009|Ga0129318_10213505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300011334|Ga0153697_1279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17083Open in IMG/M
3300011336|Ga0153703_1454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14060Open in IMG/M
3300011338|Ga0153699_1222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage23967Open in IMG/M
3300011339|Ga0153700_10768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15341Open in IMG/M
3300012352|Ga0157138_1001153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4833Open in IMG/M
3300012352|Ga0157138_1034969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage797Open in IMG/M
3300012706|Ga0157627_1083694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage958Open in IMG/M
3300012708|Ga0157595_1071457All Organisms → Viruses → Predicted Viral1645Open in IMG/M
3300012715|Ga0157599_1004978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300012720|Ga0157613_1054010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300012725|Ga0157610_1266497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300012729|Ga0157625_1265157All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300012759|Ga0157626_1136173All Organisms → Viruses → Predicted Viral1061Open in IMG/M
3300012764|Ga0157624_1120102All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300013004|Ga0164293_10062892All Organisms → cellular organisms → Bacteria2945Open in IMG/M
3300013004|Ga0164293_10121194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1980Open in IMG/M
3300013004|Ga0164293_10373081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage968Open in IMG/M
3300013004|Ga0164293_10570810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300013005|Ga0164292_10573225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300013005|Ga0164292_10578429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300013074|Ga0157618_1089634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300014050|Ga0119952_1128658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300016686|Ga0180056_1067952All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300016695|Ga0180059_1120618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300016697|Ga0180057_1163917All Organisms → Viruses → Predicted Viral1177Open in IMG/M
3300016699|Ga0180058_1124661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300017754|Ga0181344_1000453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16424Open in IMG/M
3300017780|Ga0181346_1085923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1235Open in IMG/M
3300020498|Ga0208050_1005368All Organisms → Viruses → Predicted Viral1565Open in IMG/M
3300020498|Ga0208050_1023916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300020536|Ga0207939_1002526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3916Open in IMG/M
3300020539|Ga0207941_1003046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3530Open in IMG/M
3300025585|Ga0208546_1001904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6392Open in IMG/M
3300025635|Ga0208147_1005063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales3847Open in IMG/M
3300025635|Ga0208147_1114119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300025896|Ga0208916_10332142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300025896|Ga0208916_10417250Not Available585Open in IMG/M
3300027721|Ga0209492_1023866All Organisms → Viruses → Predicted Viral2109Open in IMG/M
3300027721|Ga0209492_1085157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1115Open in IMG/M
3300027726|Ga0209285_10166457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300027762|Ga0209288_10031227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1556Open in IMG/M
3300027792|Ga0209287_10362180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300027816|Ga0209990_10010495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5758Open in IMG/M
3300027836|Ga0209230_10002931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7096Open in IMG/M
3300027836|Ga0209230_10573427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300029349|Ga0238435_101480All Organisms → Viruses → Predicted Viral4254Open in IMG/M
3300029349|Ga0238435_106005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1292Open in IMG/M
3300031787|Ga0315900_10113539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2599Open in IMG/M
3300031951|Ga0315904_10101105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3031Open in IMG/M
3300031963|Ga0315901_10381868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1136Open in IMG/M
3300033981|Ga0334982_0049037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2342Open in IMG/M
3300033995|Ga0335003_0005471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6454Open in IMG/M
3300033996|Ga0334979_0003302All Organisms → cellular organisms → Bacteria11550Open in IMG/M
3300033996|Ga0334979_0081386All Organisms → Viruses → Predicted Viral2045Open in IMG/M
3300033996|Ga0334979_0148525All Organisms → Viruses → Predicted Viral1419Open in IMG/M
3300034012|Ga0334986_0450189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300034061|Ga0334987_0796077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300034101|Ga0335027_0006389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10341Open in IMG/M
3300034104|Ga0335031_0005187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9737Open in IMG/M
3300034104|Ga0335031_0019754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4947Open in IMG/M
3300034111|Ga0335063_0033667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales3280Open in IMG/M
3300034111|Ga0335063_0114931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1607Open in IMG/M
3300034119|Ga0335054_0107249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1719Open in IMG/M
3300034200|Ga0335065_0651341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300034283|Ga0335007_0151107All Organisms → Viruses → Predicted Viral1662Open in IMG/M
3300034357|Ga0335064_0131502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1536Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater28.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment18.40%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater4.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment3.20%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.20%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment2.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.40%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.60%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.60%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary1.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352004Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002447Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion MetagenomeEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004154Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300011334Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - DaesungEnvironmentalOpen in IMG/M
3300011336Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - PaldangEnvironmentalOpen in IMG/M
3300011338Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HaengjuEnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012708Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012764Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013074Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300016686Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016695Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016697Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016699Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020539Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22000841262199352004FreshwaterMANTDKLLLICMLGMIIGFIMITIDVQRRSYEKGVRDGYHRGRSIKGEE
B570J29032_10925553623300002408FreshwaterMANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE*
B570J29032_10933025823300002408FreshwaterMSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRSIKGQE*
JGI24768J34885_1001438133300002447Freshwater And SedimentMSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE*
JGI24768J34885_1011840913300002447Freshwater And SedimentMSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE*KPVK
B570J40625_10081709333300002835FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKTAYNKGVRDGYHRGRSIKGQE*
Ga0065166_1010958033300004112Freshwater LakeMENTDKLLLICMLGMIIGFILIAIDVQRTSYKKGVRDGYHRGRSVKGQE*
Ga0066603_1040380423300004154FreshwaterMSNLDKLFIISIIGVFIGFAIVILDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0069718_1584430023300004481SedimentMTNTDKLLLICMLGMIIGFIMVTIDVQKRSYEKGVRDGYHRGRSYKGQE*
Ga0069718_1584440933300004481SedimentMSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRTYKGQE*
Ga0069718_1608761133300004481SedimentMSNNDKLLMICIIGMWIGFTMVIIDVRRTAYQKGLREGWHRGRSVSRQEFWEE*
Ga0068876_1003974563300005527Freshwater LakeMANTDKLLLICIFGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0068876_1023440123300005527Freshwater LakeMANTDKLLLICIIGMIIGFIVVIVDVQKTAYKKGVRDGYHRGRSIKGQE*
Ga0068876_1052282923300005527Freshwater LakeMSNTDKLLLICIIGMLIGFAITVFDVQRRSYEKGVRDGYHRGRSFKGQE*
Ga0068872_1072491123300005528Freshwater LakeMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0075470_1000200673300006030AqueousMANTDKLLLICIFGMIIGFVIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0070744_1007433623300006484EstuarineMANTDKLLLICMLGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE*
Ga0070744_1011071913300006484EstuarineMANTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE*
Ga0079301_111083433300006639Deep SubsurfaceMSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSVKGQE*
Ga0070749_1010913033300006802AqueousMSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRSYKGQE*
Ga0070749_1060692113300006802AqueousNKGFGAVRYKMSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0075464_1022563033300006805AqueousMSSLDKLFIISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE*
Ga0075464_1031935933300006805AqueousMANTDKLLLICIFGMIVGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0070748_108878733300006920AqueousMSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRAYKGEE*
Ga0070748_119461133300006920AqueousMANTDKLLLICIIFMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0070748_128091023300006920AqueousMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0079300_1009947733300007162Deep SubsurfaceMSNTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSYKGQE*
Ga0075458_1004824233300007363AqueousMSNTDKLLLICIIGMCIGFAITVFDVQRRSYEKGVRDGYHRGRSYKGQE*
Ga0075458_1024553423300007363AqueousMANTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0104988_10316183300007735FreshwaterMSSLDKLFIISLVGIAIGFGLVLLDVQKTAYNKGVRDGYHRGRSIKGKE*
Ga0108970_1047363033300008055EstuaryMANTDKLLLICMLGMIIGFIMITIDVQKRSYDKGVRDGYHRGRSIKGQE*
Ga0108970_1151635113300008055EstuaryMSSLDKLFIISLVGIAIGFGLVLLDVQKTAYNKGVRDGYHRGRSYKGQE*
Ga0114340_104303723300008107Freshwater, PlanktonMSNTDKLLLICIIGMIAGFIVVIIDVQKTAYNKGVRDGYHRGRSYKGQE*
Ga0114336_102819053300008261Freshwater, PlanktonMSNTDKLLLICIIGMIAGFIVVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0114363_1002710213300008266Freshwater, PlanktonMSNLDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGWHRGRNFRGDLD*
Ga0114363_124891413300008266Freshwater, PlanktonMANTDKLLLICMLGMIIGFIMITIDVQRRSYEKGVRDGYHRGRSIKGEE*
Ga0105105_1033002623300009009Freshwater SedimentMDNTDKLLLICMLGMIVGFILITMDVQRTAYKKGVRDGYHRGRNYKGQE*
Ga0105105_1091647213300009009Freshwater SedimentICMLGMIIGFILITIDVQRSSYKKGVRDGYHRGRSVKGQE*
Ga0105093_1038358023300009037Freshwater SedimentMDNTDKLLLICMLGMIVGFIIITIDVQRTAYKKGVRDGYHRGRTYKGQE*
Ga0105093_1041142313300009037Freshwater SedimentIGTEMANTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0105093_1053189613300009037Freshwater SedimentKQSRALLQIGTRMENTDKLLLICMLGMIIGFILITIDVQRTSYKKGVRDGYHRGRSIKGQE*
Ga0105098_1005107833300009081Freshwater SedimentMANTDKLLLICIIGMIIGFIIVIIDVQKTAYNKGLREGYHRGRSIKGQE*
Ga0105098_1020629723300009081Freshwater SedimentMSNLDKLFIISIIGIFIGFAIVIFDVQRTAYDKGVRDGYHRGRSIKGQE*
Ga0105098_1078490013300009081Freshwater SedimentMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGEE*
Ga0105099_1032080323300009082Freshwater SedimentMANTDKLLLICMLGMIVGFILITIDVQRSSYKKGVRDGYHRGRNYKGQE*
Ga0105099_1088350913300009082Freshwater SedimentMANTDKLLLICIFGMIVGFIIVIIDVQRTAYKKGVRD
Ga0105103_1069620613300009085Freshwater SedimentMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE*
Ga0105102_1061440423300009165Freshwater SedimentMANTDKLLLICMLGMIIGFIMITKDVQRRSYEKGVRDGYHRGRSIKGEE*
Ga0105097_1005719933300009169Freshwater SedimentMSNTDKLLIICIFGMMVGFIMILIDVQRTGYQKGLREGYHRGRSVSRQEFWEE*
Ga0105097_1013800723300009169Freshwater SedimentMSNTDKLLIICIIGMWIGFIMVIIDVRHSAYQRGQREGWHRGRSTSRQEFWEE*
Ga0105097_1032688633300009169Freshwater SedimentMSNNDKLLMICIIGMWIGLTIVIIDVRRTAYQKGLREGWHRGRSVSRQEFWEE*
Ga0105097_1039576013300009169Freshwater SedimentDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE*
Ga0105097_1046712123300009169Freshwater SedimentMANTDKLLLICILGMIVGFAIIIIDVQKSAYKKGVRDGYHRGRSIKGQE*
Ga0105097_1049112543300009169Freshwater SedimentLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE*
Ga0129333_1024336653300010354Freshwater To Marine Saline GradientVRETPDQIGLRMANTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0129333_1122941613300010354Freshwater To Marine Saline GradientMANTDKLLLICIALMVIGFAVALFDVQKRSYDKGVRDGYHRGRSFKGQE*
Ga0129333_1133780623300010354Freshwater To Marine Saline GradientMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSI
Ga0129324_1041351813300010368Freshwater To Marine Saline GradientMSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRTYKGQV*
Ga0129318_1021350533300011009Freshwater To Marine Saline GradientLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSVKGQE*
Ga0153697_127993300011334FreshwaterMANTDKLLLICMLGMIIGFIMITIDVQKRSYEKGVRDGYHRGRNFRGDLD*
Ga0153703_1454203300011336FreshwaterMSNTDKLLIIAIIGMLIGFILVLLDVQRVAYQKGLREGWHRGRSTSRQEFWEE*
Ga0153699_1222183300011338FreshwaterMSNLDKLFIISIIGIFIGFAIVIFDVQRTAYDKGVRDGYHRGRSIKGEE*
Ga0153700_1076883300011339FreshwaterMSSLDKLFIISLVGIAIGFGLVLLDVQKTAYNKGVRDGYHRGRSIKGEE*
Ga0157138_1001153103300012352FreshwaterMNNTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0157138_103496923300012352FreshwaterMQGTQLMANTDKLLLICMLGMIVGFILITIDVQRSSYKKGVRDGYHRGRSVKGKE*
Ga0157627_108369433300012706FreshwaterDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0157595_107145753300012708FreshwaterGIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0157599_100497833300012715FreshwaterVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0157613_105401013300012720FreshwaterALLQIGTEMANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE*
Ga0157610_126649713300012725FreshwaterEMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0157625_126515743300012729FreshwaterLSPIKGIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0157626_113617333300012759FreshwaterLGLRMANTDKLLLICIFGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0157624_112010213300012764FreshwaterDSSVTLSLSPIKGIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0164293_1006289213300013004FreshwaterMSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGYHRGRNFRGDLD*
Ga0164293_1012119453300013004FreshwaterMSNTDKLLLICIIGMIIGFIIVIIDVQKSAYKKGVRDGYHRGRSIKGQE*
Ga0164293_1037308123300013004FreshwaterMSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRRIKGQE*
Ga0164293_1057081023300013004FreshwaterLQLGNEMANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE*
Ga0164292_1057322523300013005FreshwaterMSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRRIKGQ
Ga0164292_1057842923300013005FreshwaterMANTDKLLLICIVGMIVGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE*
Ga0157618_108963433300013074FreshwaterGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE*
Ga0119952_112865823300014050FreshwaterMSNTDKLLLICIIGMLIGFAITVFDVQRRSYEKGVRDGYHRGRSIKGQE*
Ga0180056_106795213300016686FreshwaterAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0180059_112061823300016695FreshwaterMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIK
Ga0180057_116391713300016697FreshwaterGIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0180058_112466113300016699FreshwaterSVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0181344_1000453113300017754Freshwater LakeMENTDKLLLICMLGMIIGFILIAIDVQRTSYKKGVRDGYHRGRSVKGQE
Ga0181346_108592333300017780Freshwater LakeMANTDKLLLICIIGMIIGFAIVILDVQKTAYNKGVRDGYHRGRSYKGQE
Ga0208050_100536833300020498FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE
Ga0208050_102391633300020498FreshwaterMSNTDKLLLICIIGMIVGFIIVIIDVQKTAYKKGVRD
Ga0207939_1002526103300020536FreshwaterMTNTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE
Ga0207941_100304673300020539FreshwaterMANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE
Ga0208546_100190493300025585AqueousMANTDKLLLICIFGMIIGFVIVIIDVQKTAYKKGVRDGYHRGRSYKGQE
Ga0208147_100506373300025635AqueousMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0208147_111411923300025635AqueousMSNTDKLLLICIIGMCIGFAITVFDVQRRSYEKGVRDGYHRGRSYKGQE
Ga0208916_1033214223300025896AqueousVSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0208916_1041725013300025896AqueousMANTDKLLLICIFGMIVGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQEXEP
Ga0209492_102386653300027721Freshwater SedimentMSNTDKLLIICIFGMMVGFIMILIDVQRTGYQKGLREGYHRGRSVSRQEFWEE
Ga0209492_108515723300027721Freshwater SedimentMSNTDKLLIICIIGMWIGFIMVIIDVRHSAYQRGQREGWHRGRSTSRQEFWEE
Ga0209285_1016645723300027726Freshwater SedimentMANTDKLLLICIIGMIVGFAIAIFDVQRRSYDKGVRDGYHRGRTYKGQE
Ga0209288_1003122733300027762Freshwater SedimentMANTDKLLLICIIGMIVGFAIAIFDVQRRSYDKGVRDGYHRGRSIKGQE
Ga0209287_1036218013300027792Freshwater SedimentMENTDKLLLICMLGMIIGFILITIDVQRTSYKKGVRDGYHRGRS
Ga0209990_10010495133300027816Freshwater LakeMANTDKLLLICIIGMIIGFIVVIVDVQKTAYKKGVRDGYHRGRSIKGQE
Ga0209230_10002931143300027836Freshwater And SedimentMSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE
Ga0209230_1057342733300027836Freshwater And SedimentASGQIGKKMSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE
Ga0238435_10148053300029349FreshwaterMANTDKLLLICIIGMIIGFIVVIIDVQKSAYKKGVRDGYHRGRSIKGQE
Ga0238435_10600533300029349FreshwaterMSSLDKLFILSLIGIAVGLIIVVIDVQKTAYDKGVRDGYHRGRSYKGQE
Ga0315900_1011353943300031787FreshwaterMSNTDKLLLICIIGMIAGFIVVIIDVQKTAYKKGVRDGYHRGRSYKGQE
Ga0315904_1010110563300031951FreshwaterMSNTDKLLLICIIGMLIGFAITVFDVQRRSYEKGVRDGYHRGRSFKGQE
Ga0315901_1038186833300031963FreshwaterMSNLDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGWHRGRNFRGDLD
Ga0334982_0049037_789_9383300033981FreshwaterMSNTDKLLLICIIGMIIGFIIVIIDVQKSAYNKGVRDGYHRGRSIKGQE
Ga0335003_0005471_2600_27493300033995FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE
Ga0334979_0003302_4188_43373300033996FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE
Ga0334979_0081386_933_10823300033996FreshwaterMSNTDKLLLICIIGMIIGFIIVIIDVQKSAYKKGVRDGYHRGRSIKGQE
Ga0334979_0148525_447_5993300033996FreshwaterMSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGYHRGRNFRGDLD
Ga0334986_0450189_291_4613300034012FreshwaterLAQLGKKMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE
Ga0334987_0796077_254_4033300034061FreshwaterMSNTDKLLLICIIGMIIGFIIVIIDVQKTAYNKGVRDGYHRGRSIKGQE
Ga0335027_0006389_2811_29603300034101FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKSAYNKGVRDGYHRGRSIKGQE
Ga0335031_0005187_7214_73633300034104FreshwaterMSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRRVKGQE
Ga0335031_0019754_2382_25313300034104FreshwaterMSNTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE
Ga0335063_0033667_1755_19043300034111FreshwaterMSNTDKLLLICIIGMCIGFAITIFDVQRRSYEKGVRDGYHRGRSIKGQE
Ga0335063_0114931_1186_13353300034111FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGMRDGYHRGRSIKGQE
Ga0335054_0107249_488_6373300034119FreshwaterMANTDKLLLICIIGMIIGFIIVIIDVQKTSYKKGVRDGYHRGRSIKGQE
Ga0335065_0651341_299_4483300034200FreshwaterMTNTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE
Ga0335007_0151107_1515_16613300034283FreshwaterANTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE
Ga0335064_0131502_842_9913300034357FreshwaterMANTDKLLMICLIGMIVGFGIALFDVQKRSYEKGVRDGYHRGRSYKGQE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.