NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067789

Metagenome / Metatranscriptome Family F067789

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067789
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 48 residues
Representative Sequence MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Number of Associated Samples 109
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 44.80 %
% of genes from short scaffolds (< 2000 bps) 86.40 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.200 % of family members)
Environment Ontology (ENVO) Unclassified
(39.200 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.600 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.13%    β-sheet: 0.00%    Coil/Unstructured: 44.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF01262AlaDh_PNT_C 33.60
PF05222AlaDh_PNT_N 8.80
PF01676Metalloenzyme 4.80
PF02885Glycos_trans_3N 1.60
PF08241Methyltransf_11 1.60
PF03602Cons_hypoth95 0.80
PF12982DUF3866 0.80
PF06831H2TH 0.80
PF00117GATase 0.80
PF01488Shikimate_DH 0.80
PF14698ASL_C2 0.80
PF01175Urocanase 0.80
PF01904DUF72 0.80
PF06418CTP_synth_N 0.80
PF03129HGTP_anticodon 0.80
PF02777Sod_Fe_C 0.80
PF00144Beta-lactamase 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.80
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.80
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 0.80
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 0.80
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.80
COG2367Beta-lactamase class ADefense mechanisms [V] 0.80
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.80
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.80
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.80
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.80
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.80
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.80
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.80
COG0504CTP synthase (UTP-ammonia lyase)Nucleotide transport and metabolism [F] 0.80
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 0.80
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 0.80
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.00 %
UnclassifiedrootN/A32.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_8807713All Organisms → cellular organisms → Bacteria3061Open in IMG/M
3300000890|JGI11643J12802_10665233All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300001978|JGI24747J21853_1021265All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300003987|Ga0055471_10186031All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300003993|Ga0055468_10200681All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300004479|Ga0062595_102677296Not Available502Open in IMG/M
3300004480|Ga0062592_101724823Not Available610Open in IMG/M
3300004480|Ga0062592_101890257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia587Open in IMG/M
3300005093|Ga0062594_102196797Not Available597Open in IMG/M
3300005162|Ga0066814_10039425All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005164|Ga0066815_10103684Not Available537Open in IMG/M
3300005327|Ga0070658_10443144All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300005329|Ga0070683_101301594All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005332|Ga0066388_103443186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia808Open in IMG/M
3300005333|Ga0070677_10338936Not Available775Open in IMG/M
3300005335|Ga0070666_10516309All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium867Open in IMG/M
3300005336|Ga0070680_100850532All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300005338|Ga0068868_102206533Not Available525Open in IMG/M
3300005339|Ga0070660_101184301All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005353|Ga0070669_100611769Not Available914Open in IMG/M
3300005356|Ga0070674_102072394Not Available519Open in IMG/M
3300005406|Ga0070703_10093947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1045Open in IMG/M
3300005457|Ga0070662_101717764All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005459|Ga0068867_101862858Not Available566Open in IMG/M
3300005535|Ga0070684_101731919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia590Open in IMG/M
3300005539|Ga0068853_101156502All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005543|Ga0070672_101965480Not Available527Open in IMG/M
3300005840|Ga0068870_10676784All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005841|Ga0068863_101126343All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300005844|Ga0068862_100417294All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300005937|Ga0081455_10516879All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300006358|Ga0068871_101260090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia695Open in IMG/M
3300006574|Ga0074056_11777499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia528Open in IMG/M
3300006575|Ga0074053_11494017Not Available645Open in IMG/M
3300006580|Ga0074049_12709329All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006605|Ga0074057_11276559All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300007076|Ga0075435_100917887All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300009094|Ga0111539_11328192Not Available834Open in IMG/M
3300009098|Ga0105245_10244925All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300009101|Ga0105247_10014196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4779Open in IMG/M
3300009156|Ga0111538_11538252Not Available839Open in IMG/M
3300009177|Ga0105248_12890117Not Available548Open in IMG/M
3300009551|Ga0105238_11523604All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium698Open in IMG/M
3300009868|Ga0130016_10000094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria193899Open in IMG/M
3300009868|Ga0130016_10930007Not Available504Open in IMG/M
3300009870|Ga0131092_10000086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria186339Open in IMG/M
3300009873|Ga0131077_10007990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria22286Open in IMG/M
3300009873|Ga0131077_10022760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10566Open in IMG/M
3300010362|Ga0126377_10067327All Organisms → cellular organisms → Bacteria3175Open in IMG/M
3300012481|Ga0157320_1028764Not Available550Open in IMG/M
3300012482|Ga0157318_1003794Not Available894Open in IMG/M
3300012503|Ga0157313_1013704All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012510|Ga0157316_1029886All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium653Open in IMG/M
3300012512|Ga0157327_1093982Not Available502Open in IMG/M
3300012514|Ga0157330_1073857Not Available533Open in IMG/M
3300012515|Ga0157338_1057324Not Available576Open in IMG/M
3300012882|Ga0157304_1050557Not Available639Open in IMG/M
3300012900|Ga0157292_10060588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1043Open in IMG/M
3300012903|Ga0157289_10083610Not Available881Open in IMG/M
3300012905|Ga0157296_10184850All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium653Open in IMG/M
3300012908|Ga0157286_10270943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia608Open in IMG/M
3300012913|Ga0157298_10355051All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012914|Ga0157297_10244131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium646Open in IMG/M
3300012914|Ga0157297_10299119All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012943|Ga0164241_10250506All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300012943|Ga0164241_10402214All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300012943|Ga0164241_10610066All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300012989|Ga0164305_11857793Not Available545Open in IMG/M
3300013102|Ga0157371_11155250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium595Open in IMG/M
3300013297|Ga0157378_10803630All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300013297|Ga0157378_10823861Not Available955Open in IMG/M
3300013306|Ga0163162_12450774Not Available600Open in IMG/M
3300014325|Ga0163163_11718832All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300014745|Ga0157377_10533496All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300014968|Ga0157379_10651664All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300015371|Ga0132258_10060049All Organisms → cellular organisms → Bacteria8752Open in IMG/M
3300015372|Ga0132256_101394655All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300015374|Ga0132255_102148007Not Available851Open in IMG/M
3300019356|Ga0173481_10035658All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300019356|Ga0173481_10042442Not Available1525Open in IMG/M
3300019356|Ga0173481_10363250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes696Open in IMG/M
3300019361|Ga0173482_10004082All Organisms → cellular organisms → Bacteria3322Open in IMG/M
3300019361|Ga0173482_10017035All Organisms → cellular organisms → Bacteria1999Open in IMG/M
3300019362|Ga0173479_10089982All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300020082|Ga0206353_10467136All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300022737|Ga0247747_1033600Not Available604Open in IMG/M
3300022880|Ga0247792_1011438Not Available1371Open in IMG/M
3300022880|Ga0247792_1122471All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300022915|Ga0247790_10015595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1590Open in IMG/M
3300023069|Ga0247751_1057681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia659Open in IMG/M
3300025567|Ga0210076_1036096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1063Open in IMG/M
3300025791|Ga0210115_1095136All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025899|Ga0207642_10094846All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300025899|Ga0207642_10345884Not Available876Open in IMG/M
3300025904|Ga0207647_10447198All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300025908|Ga0207643_10123175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1537Open in IMG/M
3300025919|Ga0207657_10211461All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300025932|Ga0207690_10952194All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300025942|Ga0207689_11791968All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300025944|Ga0207661_10089296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2563Open in IMG/M
3300025945|Ga0207679_10358365All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300025972|Ga0207668_11422508Not Available625Open in IMG/M
3300026023|Ga0207677_10091374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2214Open in IMG/M
3300026023|Ga0207677_11205956All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300026089|Ga0207648_10151983All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300026121|Ga0207683_10096838All Organisms → cellular organisms → Bacteria2631Open in IMG/M
3300026905|Ga0207516_1007716All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300027437|Ga0207476_104920Not Available633Open in IMG/M
3300028590|Ga0247823_10501041Not Available916Open in IMG/M
3300028812|Ga0247825_10103690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1926Open in IMG/M
3300031576|Ga0247727_10000882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria72967Open in IMG/M
3300031576|Ga0247727_10027676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8034Open in IMG/M
3300031576|Ga0247727_10262175All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300031996|Ga0308176_11658464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales682Open in IMG/M
3300032000|Ga0310903_10105152All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300032003|Ga0310897_10148779All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300032003|Ga0310897_10396835Not Available652Open in IMG/M
3300032012|Ga0310902_11203952All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300032013|Ga0310906_10127302Not Available1448Open in IMG/M
3300032174|Ga0307470_11360313Not Available584Open in IMG/M
3300033513|Ga0316628_103814765Not Available541Open in IMG/M
3300034090|Ga0326723_0161115All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300034164|Ga0364940_0095871Not Available832Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.20%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere4.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.20%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.20%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater3.20%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm2.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.80%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.80%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.80%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.80%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.80%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.80%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A4-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027437Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_033349402088090015SoilMDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS
JGI11643J12802_1066523323300000890SoilMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQ
JGI24747J21853_102126523300001978Corn, Switchgrass And Miscanthus RhizosphereRGTASYPSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0055471_1018603123300003987Natural And Restored WetlandsVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0055468_1020068113300003993Natural And Restored WetlandsMDTALGLLELLLYIVAILALSMSVTWAVVKVSPSESAKEQRDRTDADATS*
Ga0063356_10238832123300004463Arabidopsis Thaliana RhizosphereMRPMDTALGLVELVLYVAGILALSMAITWVVVKVSPSESAKEQTAKDASEG*
Ga0062595_10267729623300004479SoilMDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS*
Ga0062592_10172482323300004480SoilVDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS*
Ga0062592_10189025723300004480SoilMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0058861_1198228813300004800Host-AssociatedFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0062594_10219679723300005093SoilMDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS*
Ga0066814_1003942513300005162SoilDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0066815_1010368413300005164SoilMDTILSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS*
Ga0070658_1044314423300005327Corn RhizosphereMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0070683_10130159423300005329Corn RhizosphereMDTVISLLELLVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0066388_10344318623300005332Tropical Forest SoilMDTVISLVELTVYIVAILALSMSVTWAVVKVSPSESAKEQRAKDKGETSTS*
Ga0070677_1033893623300005333Miscanthus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS*
Ga0070666_1051630923300005335Switchgrass RhizosphereMDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEAKAKS*
Ga0070680_10085053223300005336Corn RhizosphereASYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0068868_10220653313300005338Miscanthus RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRA
Ga0070660_10118430123300005339Corn RhizosphereGTASYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0070669_10061176913300005353Switchgrass RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQR
Ga0070674_10207239423300005356Miscanthus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES*
Ga0070703_1009394723300005406Corn, Switchgrass And Miscanthus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0070662_10171776413300005457Corn RhizosphereYPSPPVDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS*
Ga0068867_10186285823300005459Miscanthus RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES*
Ga0070684_10173191923300005535Corn RhizosphereMDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS*
Ga0068853_10115650213300005539Corn RhizosphereLGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS*
Ga0070672_10196548023300005543Miscanthus RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQR
Ga0068870_1067678423300005840Miscanthus RhizospherePMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0068863_10112634323300005841Switchgrass RhizosphereMDTVLSLVELAAYIVGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS*
Ga0068862_10041729423300005844Switchgrass RhizosphereMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0081455_1051687923300005937Tabebuia Heterophylla RhizosphereMDTALSLLELLLYILAILALSMSVTWAVVKVSPSESAKEQRDRTDANGKS*
Ga0068871_10126009023300006358Miscanthus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0074056_1177749923300006574SoilVDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0074053_1149401723300006575SoilMDTVLSLVELVAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEAKAKS*
Ga0074049_1270932923300006580SoilTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS*
Ga0074057_1127655923300006605SoilMDTVLSLVELVAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS*
Ga0075435_10091788713300007076Populus RhizosphereASYPSQPMDTAFSLLELLVYILAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES*
Ga0111539_1132819223300009094Populus RhizosphereMDTALSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRA
Ga0105245_1024492523300009098Miscanthus RhizosphereMDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAESEATTKS*
Ga0105247_1001419623300009101Switchgrass RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRALAEAKAKS*
Ga0111538_1153825223300009156Populus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKE
Ga0105248_1289011713300009177Switchgrass RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSES
Ga0105238_1152360423300009551Corn RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEA
Ga0130016_100000941873300009868WastewaterVDTVISLLELFLYIAAILALSMSVTWAVVKISPSESAKEQRGRTDAKAKS*
Ga0130016_1093000723300009868WastewaterMDTVISLLELTLYIVAILALSMSVTWAVVKVSPSESARQQRAQ
Ga0131092_10000086153300009870Activated SludgeMDTVLSLLELVLYIAGILGLSMFVTWAVVKVSPSESAKQQRAQADDKAKA*
Ga0131077_1000799043300009873WastewaterMDTVISLVELTVYIVGILALSMSVTWAVVKVSPSESAKEQRAQEKGEAKKA*
Ga0131077_1002276023300009873WastewaterMDTVISLLELTLYIAGILGLSMFVTWAVVKVSPSESAKQQRAQAKGEAKT*
Ga0126377_1006732743300010362Tropical Forest SoilMDTVFSLSELILYIAAILALSMAVTWAVVRVSPSESAKEQQASEKAKT*
Ga0157320_102876423300012481Arabidopsis RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKDEAKA*
Ga0157318_100379423300012482Arabidopsis RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKG*
Ga0157313_101370423300012503Arabidopsis RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0157316_102988623300012510Arabidopsis RhizosphereMDTVLSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKE
Ga0157327_109398213300012512Arabidopsis RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSEGAKEQRAQEQGEAKA*
Ga0157330_107385713300012514SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEQGEAKA*
Ga0157338_105732413300012515Arabidopsis RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRA
Ga0157304_105055713300012882SoilMDTAFSLLELLVYILAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0157292_1006058823300012900SoilMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES*
Ga0157289_1008361023300012903SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAE
Ga0157296_1018485023300012905SoilMDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAK
Ga0157286_1027094323300012908SoilMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKVQRAQAKAKAKS*
Ga0157298_1035505113300012913SoilMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS*
Ga0157297_1024413123300012914SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESA
Ga0157297_1029911923300012914SoilMETVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0164241_1025050623300012943SoilMDTVISLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKG*
Ga0164241_1040221423300012943SoilMDTVLSLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0164241_1061006623300012943SoilMDNVISLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0164305_1185779313300012989SoilMDTVLSLVELVAYIGGILALSMSVTWAVVRISPSESAKEQRAQAKEQRAQAKGEANT*
Ga0157371_1115525013300013102Corn RhizosphereELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0157378_1080363023300013297Miscanthus RhizosphereSLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0157378_1082386123300013297Miscanthus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAK
Ga0163162_1245077413300013306Switchgrass RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKA
Ga0163163_1171883213300014325Switchgrass RhizosphereLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS*
Ga0157377_1053349623300014745Miscanthus RhizosphereMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS*
Ga0157379_1065166433300014968Switchgrass RhizosphereLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0132258_1006004923300015371Arabidopsis RhizosphereMDTVISLLELIVYIVAILALSMSVTWAVVKVSPSESAKEQRAQEKDEAKA*
Ga0132256_10139465523300015372Arabidopsis RhizosphereMDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQEQGEAKA*
Ga0132255_10214800713300015374Arabidopsis RhizosphereISLLELFVYIVAILGLSMAVTWAVVKVSPSESAKEQRAQEKGEAKA*
Ga0173481_1003565823300019356SoilMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0173481_1004244223300019356SoilVDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS
Ga0173481_1036325023300019356SoilMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0173482_1000408223300019361SoilMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0173482_1001703523300019361SoilVDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS
Ga0173479_1008998223300019362SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0206353_1046713623300020082Corn, Switchgrass And Miscanthus RhizosphereLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0247747_103360013300022737SoilMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQE
Ga0247792_101143823300022880SoilMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEK
Ga0247792_112247113300022880SoilTASYPSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0247790_1001559533300022915SoilPMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS
Ga0247751_105768123300023069SoilMDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS
Ga0210076_103609623300025567Natural And Restored WetlandsMDTALGLLELLLYIVAILALSMSVTWAVVKVSPSESAKEQRDRTDADATS
Ga0210115_109513613300025791Natural And Restored WetlandsVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0207642_1009484633300025899Miscanthus RhizosphereYPSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0207642_1034588423300025899Miscanthus RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSE
Ga0207647_1044719823300025904Corn RhizosphereMDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS
Ga0207643_1012317523300025908Miscanthus RhizosphereMDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEAKAKS
Ga0207657_1021146133300025919Corn RhizosphereSYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0207690_1095219423300025932Corn RhizosphereMDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRAEPDAKS
Ga0207689_1179196823300025942Miscanthus RhizosphereLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0207661_1008929643300025944Corn RhizosphereLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0207679_1035836523300025945Corn RhizospherePSPSMDTVLSLVELVAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS
Ga0207668_1142250813300025972Switchgrass RhizosphereMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAK
Ga0207677_1009137433300026023Miscanthus RhizosphereSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0207677_1120595623300026023Miscanthus RhizosphereSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS
Ga0207648_1015198313300026089Miscanthus RhizosphereMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAK
Ga0207683_1009683843300026121Miscanthus RhizosphereVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0207516_100771623300026905SoilPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0207476_10492013300027437SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA
Ga0247823_1050104123300028590SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQ
Ga0247825_1010369033300028812SoilARGTASYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAK
Ga0247727_10000882533300031576BiofilmMQPMDTVLSLVELVFYVIAVLALSMAITWVVVKVSPSESAKQQKAQQTET
Ga0247727_1002767663300031576BiofilmMQPMDTAISLLELVFYVIAVLALSMAITWVVVKVSPSESAKQQKAQQTET
Ga0247727_1026217523300031576BiofilmMQPMDTALSLLELVFYVMAVLALSMAITWVVVKVSPSESAKQQKAQQTDT
Ga0308176_1165846423300031996SoilMDTVLSLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0310903_1010515223300032000SoilMDTALSLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0310897_1014877923300032003SoilRPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS
Ga0310897_1039683523300032003SoilMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQA
Ga0310902_1120395213300032012SoilELFVYIAGILGLSVFVTWSVVKVSPSESAKEQRAQAEAKAKS
Ga0310906_1012730213300032013SoilMHTALSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS
Ga0307470_1136031313300032174Hardwood Forest SoilMDTALSLVELTAYIVAILALSMSVTWAVVRISPSESAKEQRAQAKEQRA
Ga0316628_10381476523300033513SoilVDTVISLVELFFYIAAILALSASVTWAVVKVSPSESAKEQRAEADAKAKG
Ga0326723_0161115_330_4823300034090Peat SoilVDTVIGLFELFFYIVAILALSASVTWAVVKISPSESAKEQRAETDAKAKG
Ga0364940_0095871_696_8303300034164SedimentMQPMDTVLSLLELVFYVMAVLALSMAITWVVVKVSPSESAKQQKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.