NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F067795

Metagenome Family F067795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067795
Family Type Metagenome
Number of Sequences 125
Average Sequence Length 41 residues
Representative Sequence KPTVGAMKLELELDQRDMGLKELPKPEQIYDFSILDELAKR
Number of Associated Samples 103
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.80 %
% of genes near scaffold ends (potentially truncated) 96.80 %
% of genes from short scaffolds (< 2000 bps) 95.20 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.600 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(11.200 % of family members)
Environment Ontology (ENVO) Unclassified
(24.800 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.600 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.23%    β-sheet: 0.00%    Coil/Unstructured: 63.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF09084NMT1 16.00
PF12172DUF35_N 12.00
PF01796OB_aCoA_assoc 5.60
PF01522Polysacc_deac_1 4.00
PF01738DLH 3.20
PF01797Y1_Tnp 2.40
PF08239SH3_3 1.60
PF07719TPR_2 1.60
PF13649Methyltransf_25 1.60
PF02436PYC_OADA 1.60
PF04365BrnT_toxin 0.80
PF00682HMGL-like 0.80
PF12156ATPase-cat_bd 0.80
PF05598DUF772 0.80
PF01842ACT 0.80
PF14559TPR_19 0.80
PF11799IMS_C 0.80
PF00589Phage_integrase 0.80
PF04909Amidohydro_2 0.80
PF07589PEP-CTERM 0.80
PF01547SBP_bac_1 0.80
PF00291PALP 0.80
PF13240zinc_ribbon_2 0.80
PF03466LysR_substrate 0.80
PF13419HAD_2 0.80
PF02515CoA_transf_3 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 16.00
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 16.00
COG1545Uncharacterized OB-fold protein, contains Zn-ribbon domainGeneral function prediction only [R] 5.60
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 4.00
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 2.40
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.80
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.60 %
UnclassifiedrootN/A6.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000655|AF_2010_repII_A100DRAFT_1019339All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1074614All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300000891|JGI10214J12806_13108005All Organisms → cellular organisms → Bacteria → Proteobacteria956Open in IMG/M
3300000953|JGI11615J12901_11363941All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300002128|JGI24036J26619_10064596All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300003998|Ga0055472_10099976All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300003999|Ga0055469_10166561All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300004643|Ga0062591_101062197All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005295|Ga0065707_10751540Not Available605Open in IMG/M
3300005331|Ga0070670_100577460All Organisms → cellular organisms → Bacteria → Proteobacteria1004Open in IMG/M
3300005332|Ga0066388_105341021All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005367|Ga0070667_100768709All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005440|Ga0070705_101469077All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300005536|Ga0070697_100880098All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300005543|Ga0070672_100203605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1655Open in IMG/M
3300005543|Ga0070672_101958241All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005546|Ga0070696_100183597All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300005546|Ga0070696_101908682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria514Open in IMG/M
3300005764|Ga0066903_107010149All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006032|Ga0066696_10209507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1247Open in IMG/M
3300006358|Ga0068871_100828691Not Available854Open in IMG/M
3300006796|Ga0066665_10958839All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006800|Ga0066660_11600226All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006852|Ga0075433_11239297Not Available647Open in IMG/M
3300006871|Ga0075434_100984274All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300006904|Ga0075424_100871146All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300006914|Ga0075436_100134167All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300007076|Ga0075435_100413955All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300009012|Ga0066710_104221941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300009036|Ga0105244_10390878All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300009088|Ga0099830_11728660All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009100|Ga0075418_11175046All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300009100|Ga0075418_11428605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300009100|Ga0075418_12250999All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300009111|Ga0115026_11199921All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300009143|Ga0099792_11026246All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK552Open in IMG/M
3300009147|Ga0114129_10411588All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300009147|Ga0114129_11857816All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300009148|Ga0105243_11141476All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300009157|Ga0105092_10701753All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300009162|Ga0075423_12538155All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009167|Ga0113563_12992787All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300010047|Ga0126382_11919765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300010336|Ga0134071_10015621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3135Open in IMG/M
3300010360|Ga0126372_11658677All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300010360|Ga0126372_12146106All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010362|Ga0126377_11692021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300010366|Ga0126379_10461201All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300010373|Ga0134128_10600103All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300010376|Ga0126381_103303100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300010397|Ga0134124_10381776All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300010400|Ga0134122_11233762All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300010403|Ga0134123_11158512All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300010868|Ga0124844_1126225All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300011444|Ga0137463_1337247All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012202|Ga0137363_10289179All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300012357|Ga0137384_11398470All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012499|Ga0157350_1059016All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012515|Ga0157338_1037107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300012925|Ga0137419_10355695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1134Open in IMG/M
3300012927|Ga0137416_10886893All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300012929|Ga0137404_10129192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2077Open in IMG/M
3300012971|Ga0126369_11193573All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300012971|Ga0126369_12248045All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300012976|Ga0134076_10409102All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012987|Ga0164307_10262898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1211Open in IMG/M
3300015241|Ga0137418_10946667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300015371|Ga0132258_10696222All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300015371|Ga0132258_12529621All Organisms → cellular organisms → Bacteria → Proteobacteria1284Open in IMG/M
3300015372|Ga0132256_100247064All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300015372|Ga0132256_100837524Not Available1036Open in IMG/M
3300015374|Ga0132255_100549233All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300015374|Ga0132255_102700211All Organisms → cellular organisms → Bacteria → Proteobacteria759Open in IMG/M
3300015374|Ga0132255_103970789All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300015374|Ga0132255_105214287All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK550Open in IMG/M
3300016270|Ga0182036_10135108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1734Open in IMG/M
3300016404|Ga0182037_12051159All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK514Open in IMG/M
3300018027|Ga0184605_10215174All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300018032|Ga0187788_10204185All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300018053|Ga0184626_10428175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300018072|Ga0184635_10147969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium938Open in IMG/M
3300018072|Ga0184635_10165191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium884Open in IMG/M
3300018075|Ga0184632_10483406Not Available510Open in IMG/M
3300018076|Ga0184609_10008274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3782Open in IMG/M
3300018076|Ga0184609_10314229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium732Open in IMG/M
3300018079|Ga0184627_10448727All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300018429|Ga0190272_13180119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria511Open in IMG/M
3300018466|Ga0190268_11971332All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300018476|Ga0190274_12253646All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300019881|Ga0193707_1012302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2896Open in IMG/M
3300022534|Ga0224452_1189972All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300022756|Ga0222622_11125499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria578Open in IMG/M
3300025908|Ga0207643_11007126All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025917|Ga0207660_11127422All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300025930|Ga0207701_10763837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium816Open in IMG/M
3300025930|Ga0207701_11329622All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium588Open in IMG/M
3300025936|Ga0207670_10584265All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300025945|Ga0207679_11607842All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300025945|Ga0207679_11801489All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300025959|Ga0210116_1009789All Organisms → cellular organisms → Bacteria → Proteobacteria1725Open in IMG/M
3300025959|Ga0210116_1095531Not Available585Open in IMG/M
3300026089|Ga0207648_10252830All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1571Open in IMG/M
3300026089|Ga0207648_11869263Not Available562Open in IMG/M
3300027513|Ga0208685_1012477All Organisms → cellular organisms → Bacteria → Proteobacteria2028Open in IMG/M
3300027815|Ga0209726_10238302All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300027840|Ga0209683_10249755All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300027907|Ga0207428_10176803All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300027909|Ga0209382_11263561All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300027909|Ga0209382_11828297All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300030619|Ga0268386_10137224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1871Open in IMG/M
(restricted) 3300031197|Ga0255310_10242493All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031538|Ga0310888_10247353All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300031720|Ga0307469_10274240All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300031820|Ga0307473_10585686All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300031852|Ga0307410_11414190All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031941|Ga0310912_11167789All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032075|Ga0310890_10227999All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300032144|Ga0315910_10859995All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300032174|Ga0307470_10136259All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300032205|Ga0307472_100190478All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300032205|Ga0307472_100383576All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300032770|Ga0335085_11039613All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300033413|Ga0316603_11165304All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300034164|Ga0364940_0033019Not Available1351Open in IMG/M
3300034164|Ga0364940_0165923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29640Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.20%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere2.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.40%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.60%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.80%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.80%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.80%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.80%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.80%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.80%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.80%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A100DRAFT_101933923300000655Forest SoilGRPTANAQKLDGELTRRNMGLKEPAKTEQIYDFSLLDELKQK*
AF_2010_repII_A100DRAFT_107461423300000655Forest SoilPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEELGKR*
JGI10214J12806_1310800513300000891SoilEFELDQRDMGLKEMPKAEQVFDFSLLDEVLAQKR*
JGI11615J12901_1136394123300000953SoilDGRPTAGAVKLDAELSQRDMGLKELPKVEQTYDFSILDELAKK*
JGI24036J26619_1006459613300002128Corn, Switchgrass And Miscanthus RhizosphereWAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0055472_1009997613300003998Natural And Restored WetlandsLDGKPTAAAMKLEFELDERLMNLKETPKPEQIYDFSLLDAVEKK*
Ga0055469_1016656123300003999Natural And Restored WetlandsTANAMKLEFELDQRSMNLKELPKPEQIYDFSLLDEASKR*
Ga0062591_10106219713300004643SoilALDGKPTAAANKLDFELTQRDMGLKEPPKMEQVYDFSLLDELAKR*
Ga0065707_1075154023300005295Switchgrass RhizosphereGAWALDSRPTANAQRLDAELTRRSMGLKEPAKPEQIYDFSLLDELKQK*
Ga0070670_10057746033300005331Switchgrass RhizosphereNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0066388_10534102113300005332Tropical Forest SoilALDGKPTPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEKLGKR*
Ga0070667_10076870933300005367Switchgrass RhizosphereKGWAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0070705_10146907723300005440Corn, Switchgrass And Miscanthus RhizosphereGRPTVEVLKLDAELSQRDMGLKELPRPEQTYDLSMLDELAKR*
Ga0070697_10088009823300005536Corn, Switchgrass And Miscanthus RhizosphereWALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK*
Ga0070672_10020360513300005543Miscanthus RhizosphereNANKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR*
Ga0070672_10195824123300005543Miscanthus RhizosphereVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0070696_10018359733300005546Corn, Switchgrass And Miscanthus RhizosphereAWALDGRPTANAQKLDAELTRRNMGMKEPAKPEQIYDFSLLDELKQK*
Ga0070696_10190868223300005546Corn, Switchgrass And Miscanthus RhizosphereTPGSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQKR*
Ga0066903_10701014913300005764Tropical Forest SoilALDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSMLDELAKR*
Ga0066696_1020950733300006032SoilGSWALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK*
Ga0068871_10082869123300006358Miscanthus RhizosphereDGRPSVNANKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR*
Ga0066665_1095883913300006796SoilTKFEFELDQRDMGLKEPPRPEQVYDFSLLEELAKR*
Ga0066660_1160022613300006800SoilMKLEFELDQRDMGLKELPKVDQVYDFSLLEESGRR*
Ga0075433_1123929713300006852Populus RhizosphereNVEGAWALDGRPTANAQKLDAELTRRSMGLKEPPKSEQIYDFSLLDELKQR*
Ga0075434_10098427423300006871Populus RhizosphereGALKLELELDQKDAGLKELPKAEQIYDFSLLDELEKR*
Ga0075424_10087114613300006904Populus RhizosphereIHKGWAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0075436_10013416733300006914Populus RhizospherePGATKFEFEIDQRDMGLKEPPKPEQVFDFSLLDEVAKR*
Ga0075435_10041395523300007076Populus RhizospherePTIGSQSFEFELAQREMGLKEPPKPEQVYDFSILDEISKR*
Ga0066710_10422194123300009012Grasslands SoilSWALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK
Ga0105244_1039087813300009036Miscanthus RhizosphereTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0099830_1172866023300009088Vadose Zone SoilRPTPGSQKFEFDLAQRDMGLKEPPKPEQVYDFSLLEELAKR*
Ga0075418_1117504613300009100Populus RhizosphereEALKLELELDQKDAGLKELPKAEQIYDFSLLDEVTKR*
Ga0075418_1142860513300009100Populus RhizosphereGWALDGKPTAGAMKLEFELDQRDMGLKELPRAEQIYDFSLLDGLARR*
Ga0075418_1225099923300009100Populus RhizosphereRPSVNANKLDFEMTQRDMGLKEPPRLEQIYDFSLLDEIAKR*
Ga0115026_1119992123300009111WetlandLDGRPTPGAVKLDAELSQRDMGLKELPKAEQTYDFSMLDELAKR*
Ga0099792_1102624613300009143Vadose Zone SoilKGWSVDGKPTPGALKLELELDQKDAGLKDLPKPEQIYDFALLDEIAKR*
Ga0114129_1041158813300009147Populus RhizosphereKGWSVDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSLLDELAKK*
Ga0114129_1185781613300009147Populus RhizosphereNFEFALAQREMGLKEPPKPEQVYDFSILDEISKR*
Ga0105243_1114147613300009148Miscanthus RhizosphereGSQKFEFDLAQREMGLKEPPKPEQVYDFSILEEVTKK*
Ga0105092_1070175323300009157Freshwater SedimentALKLELELDQKDAGLKELPKPEQIYDFSMLDELAKR*
Ga0075423_1253815513300009162Populus RhizosphereKPTPGALKLELELDQKDAGLKELPKAEQIYDFSLLDELEKR*
Ga0113563_1299278723300009167Freshwater WetlandsKLDAELSQRDMGLKELPRAEQTYDFSMLDELTKR*
Ga0126382_1191976523300010047Tropical Forest SoilAAMKLELELDQRDLGLKELPRPEQIYDFSLLSELPKK*
Ga0134071_1001562113300010336Grasslands SoilGKPTPGAMKLEFELDQRDMGLKELPRAEQIYDFSLLDELARR*
Ga0126372_1165867723300010360Tropical Forest SoilGKPTPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEELGKR*
Ga0126372_1214610623300010360Tropical Forest SoilTKFEFEIDQRDMGLKEFPKPEQVFDFSLLEELAKR*
Ga0126377_1169202113300010362Tropical Forest SoilNKLDFALTQRDMGLKEPPKLEQIYDFSLLDEIAKR*
Ga0126379_1046120123300010366Tropical Forest SoilPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEKLGKR*
Ga0134128_1060010313300010373Terrestrial SoilWAVNGRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVAKR*
Ga0126381_10330310023300010376Tropical Forest SoilSINANKLDFALTQRDMRLKEPPKLEQIYDFSLLDEIAKR*
Ga0134124_1038177633300010397Terrestrial SoilGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVAKR*
Ga0134122_1123376213300010400Terrestrial SoilAGALKCDAELSKRDMGLKELPRPEQTYDLSMLDELVKR*
Ga0134123_1115851233300010403Terrestrial SoilPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK*
Ga0124844_112622513300010868Tropical Forest SoilKFEFEIDQRDMGLKEFPSPEQVFDFSLLDEVANR*
Ga0137463_133724723300011444SoilANANKLDFELTQRDMGLKEPPKMEQIYDFSLLDELAKR*
Ga0137363_1028917933300012202Vadose Zone SoilKLELELDQKDAGLKELPRAEQIYDFSLLDELAKR*
Ga0137384_1139847013300012357Vadose Zone SoilIHKGWAVDGKPTPGALKVELELDQKDAGLKELPKPEQIYDFSLLDELAKK*
Ga0157350_105901623300012499Unplanted SoilPGSQKFEFDLAQREMGLKEPPKPEQVYDFSILEELTKK*
Ga0157338_103710713300012515Arabidopsis RhizosphereNKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR*
Ga0137419_1035569523300012925Vadose Zone SoilALDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK*
Ga0137416_1088689313300012927Vadose Zone SoilPTPGSQKFEFDLAQREMGLKEPPKPEQVYDFSILDEIARR*
Ga0137404_1012919213300012929Vadose Zone SoilPTPGALKLELELDQKDAGLKELPKVEQIYDFSMLDELAKR*
Ga0126369_1119357323300012971Tropical Forest SoilTPGALKLELELDQKDAGLKELPKPEQIYDFSMLDELAKR*
Ga0126369_1224804523300012971Tropical Forest SoilPTPAAMKLEFELDQRDLGLKEPPKAEQIYDFSLLEELGKR*
Ga0134076_1040910213300012976Grasslands SoilRPSRGAMKLEFELDQRDMGLKELPKVDQVYDFSLLEESGKR*
Ga0164307_1026289813300012987SoilLKLELELDQKDAGLKELPKPEQIYDFSLLDEVAKR*
Ga0137418_1094666713300015241Vadose Zone SoilDAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK*
Ga0132258_1069622213300015371Arabidopsis RhizosphereHKGWAVDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSILDELAKR*
Ga0132258_1252962113300015371Arabidopsis RhizosphereKLELELDQKDAGLKELPKPEQIYDFSLLDEIGRR*
Ga0132256_10024706413300015372Arabidopsis RhizospherePTSGALKLDVQLSQKDAGLKELPEPEQIYDFSLLDEIAKR*
Ga0132256_10083752413300015372Arabidopsis RhizosphereSVDGRPSVNANKLDFELTQRDMGVKEPPKLEQIYDFSLLDEIAKR*
Ga0132255_10054923313300015374Arabidopsis RhizosphereRPTAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVTTNKGM*
Ga0132255_10270021113300015374Arabidopsis RhizospherePGALKLELELDQKDAGLKELPKPEQIYDFSLLDEITRR*
Ga0132255_10397078913300015374Arabidopsis RhizosphereGALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVRK*
Ga0132255_10521428723300015374Arabidopsis RhizosphereGALKLELELDQKDAGLKELPKPEQIYDFSLLDEITRR*
Ga0182036_1013510813300016270SoilEGAWALDGRPTASAHKLDAELTRRNMGLKEAPKPEQIYDFSLLDESKQK
Ga0182037_1205115923300016404SoilAEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKR
Ga0184605_1021517423300018027Groundwater SedimentGKPTVGAMKLELELDQRDMGLKELPKPEQIYDFSILDELAKR
Ga0187788_1020418523300018032Tropical PeatlandWALDGKPTPGALKLELELDQRDAGLKEFPKPEQIYDFSMLGELAKR
Ga0184626_1042817523300018053Groundwater SedimentALDGKPTAGALKLELELDQRDMGLKELPKPEQIYDFSLLDEVGKR
Ga0184635_1014796913300018072Groundwater SedimentRFGATKFEFDIDQRLKEPPRPEQVFDFSLLDELGKR
Ga0184635_1016519133300018072Groundwater SedimentPGSQKFEFDLAQREMGLKEPPKPEQVYDFSILDEVAKK
Ga0184632_1048340623300018075Groundwater SedimentLDGKPTAAAMKLDAELSMRDMGLKELPKPEQSYDFSLLDEVGKR
Ga0184609_1000827433300018076Groundwater SedimentKPTAGALKLELELDQRDMGLKELPKPEQIYDFSLLDEVGRR
Ga0184609_1031422923300018076Groundwater SedimentGATEFEFDLDQRDMGLKEPPRPEQVYDFSLLDELAKR
Ga0184627_1044872713300018079Groundwater SedimentGWALDGRPTPAALKLDAELSQRDMGLKELPRPEQTYDLSMLDEITKR
Ga0190272_1318011923300018429SoilSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQRR
Ga0190268_1197133213300018466SoilMKFEFELAQREMSLKEPPRPEQVYDFSILDELSKK
Ga0190274_1225364613300018476SoilPTANAIKLDAELSQRDMGLKELPRVEQTYDFSMLDELTKK
Ga0193707_101230213300019881SoilDGRPTADAQKLDAELTRRNMGLKEPAKPEQIYDFSLLDELAKK
Ga0224452_118997213300022534Groundwater SedimentKPTVGAMKLELELDQRDMGLKELPKPEQIYDFSILDELAKR
Ga0222622_1112549923300022756Groundwater SedimentKGWAKDGRTTPGSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQKR
Ga0207643_1100712613300025908Miscanthus RhizosphereEALKLELELDQKDAGLKELPKPEQIYDFSLLDEVVKK
Ga0207660_1112742223300025917Corn RhizosphereKGWALDGKPTANAMKLEFDLDQRDMGLKELPKAEQLFDFSLLDEALAQKR
Ga0207701_1076383723300025930Corn, Switchgrass And Miscanthus RhizospherePTASAQKLDAELTRRNMGMKEPAKPEQIYDFSLLDELKQK
Ga0207701_1132962223300025930Corn, Switchgrass And Miscanthus RhizospherePGSMKLEFELDQRDMDLKEMPKPEQIYDYSILDELAKQKR
Ga0207670_1058426533300025936Switchgrass RhizosphereTPGSQKFEFDLAQREMGLKEPPKPEQVYDFSILDELAKK
Ga0207679_1160784223300025945Corn RhizosphereGRPTIGSQSFEFELAQREMGLKEPPKPEQVYDFSILDEISKR
Ga0207679_1180148913300025945Corn RhizosphereVDGKPTPGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVAKR
Ga0210116_100978913300025959Natural And Restored WetlandsVKLDAELSQRDMGLKELPRPEQTYDLSMLDELAKR
Ga0210116_109553123300025959Natural And Restored WetlandsLLAGWALDGKPTPAAMKLEFELDERLMNLKETPKPEQIYDFSLLDAVGKK
Ga0207648_1025283023300026089Miscanthus RhizospherePTPGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVVKK
Ga0207648_1186926323300026089Miscanthus RhizospherePSVNANKLDFELTQRDMGLKEPPKLEQIYDFSLLDEIAKR
Ga0208685_101247713300027513SoilAIRPGWALDGRPTAGAVKLDAELSQRDMGLKELPRPEQTYDFSMLEELTRKQ
Ga0209726_1023830223300027815GroundwaterGWALDGRPTPGAVKLDAELSQRDMGLKELPRVDQTYDFSMLDELIKK
Ga0209683_1024975523300027840Wetland SedimentALDGRPTPGAVKLDAELSQRDLGLKELPRPEQTYDFSMLDELGKK
Ga0207428_1017680333300027907Populus RhizosphereDGKPTPGALKLELELDQKDAGLKELPKPEQIYDFSLLDELAKK
Ga0209382_1126356113300027909Populus RhizosphereALKLDAELSRRDMGLKELPRPEQTYDFSMLDELANR
Ga0209382_1182829723300027909Populus RhizosphereMPINLTFEMTQRDMGLKEPPRLEQIYDFSLLDEIAKR
Ga0268386_1013722423300030619SoilMRLEFELDQRDMNLKETPKPEQVYDFSLLDEVGRK
(restricted) Ga0255310_1024249323300031197Sandy SoilGRPSPGALKLDAELSQRDMGLKELPRPEQTYDLSLLDELAKR
Ga0310888_1024735323300031538SoilPAAANKLDFELTQRDMGLKEVPKMEQVYDFSLLDELAKR
Ga0307469_1027424033300031720Hardwood Forest SoilGKPTPAAMKLEFELDQRDLGLKEPPKPEQIYDFSLLEELGKR
Ga0307473_1058568613300031820Hardwood Forest SoilDGKPTAAAMKLEFELDQRDLGLKEPPKPEQIYDFSLLEELSKR
Ga0307410_1141419013300031852RhizosphereKPTAAANKLDFELTQRDMGLKEVPKMEQVYDFSLLDELAKR
Ga0310912_1116778913300031941SoilVDGKPTPGALKLELELDQKDAGLKELPRAEQIYDFSMLDELAKR
Ga0310890_1022799923300032075SoilTPGALKLELELDQKDAGLKEPPKPEQIYDFSLLDEVVRK
Ga0315910_1085999513300032144SoilASMKLEFELDQRDMGLKDLPKPEQIYDFSILEELSKR
Ga0307470_1013625933300032174Hardwood Forest SoilPTPGATKFEFEIDQRDMGLKEMPRSEQVFDFSLLEELAKR
Ga0307472_10019047833300032205Hardwood Forest SoilRLWLLRNGRPTANAQKLDAELTRRSMGLKEPPKSEQIYDFSLLDELKQR
Ga0307472_10038357623300032205Hardwood Forest SoilPTANAQKLDAELTRRSMGLKEPPRSEQIYDFSLLDELKQR
Ga0335085_1103961323300032770SoilGATKFEFEIDQRDMGLKEFPKPEQVFDFSLLEELTRR
Ga0316603_1116530423300033413SoilRPTAGAIKLDAELSQRDMGLKELPRPEQTYDFSMLEELTRKQ
Ga0364940_0033019_877_9873300034164SedimentLKFVLGEQAQRDMGLKEQPKPEQVYDFSLLDEVAKR
Ga0364940_0165923_509_6403300034164SedimentDGKPTPGALKLEFELDQRDLGLKEPPKLEQVYDFSLLDELGSR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.