Basic Information | |
---|---|
Family ID | F067908 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 125 |
Average Sequence Length | 46 residues |
Representative Sequence | MNGVGKRRVELLIPMRTLLLVAAAIGVLAAFVAIGDTFLIVFVGI |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 62.75 % |
% of genes near scaffold ends (potentially truncated) | 81.60 % |
% of genes from short scaffolds (< 2000 bps) | 78.40 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.400 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.400 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.400 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF07885 | Ion_trans_2 | 24.00 |
PF03706 | LPG_synthase_TM | 13.60 |
PF04020 | Phage_holin_4_2 | 4.00 |
PF06224 | HTH_42 | 3.20 |
PF01699 | Na_Ca_ex | 3.20 |
PF04237 | YjbR | 3.20 |
PF00282 | Pyridoxal_deC | 2.40 |
PF12706 | Lactamase_B_2 | 2.40 |
PF03631 | Virul_fac_BrkB | 2.40 |
PF13396 | PLDc_N | 1.60 |
PF13191 | AAA_16 | 0.80 |
PF13091 | PLDc_2 | 0.80 |
PF13489 | Methyltransf_23 | 0.80 |
PF01569 | PAP2 | 0.80 |
PF13278 | Obsolete Pfam Family | 0.80 |
PF13483 | Lactamase_B_3 | 0.80 |
PF01741 | MscL | 0.80 |
PF00528 | BPD_transp_1 | 0.80 |
PF00144 | Beta-lactamase | 0.80 |
PF02535 | Zip | 0.80 |
PF14023 | DUF4239 | 0.80 |
PF04311 | DUF459 | 0.80 |
PF08386 | Abhydrolase_4 | 0.80 |
PF07690 | MFS_1 | 0.80 |
PF08447 | PAS_3 | 0.80 |
PF02559 | CarD_CdnL_TRCF | 0.80 |
PF13411 | MerR_1 | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 13.60 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 4.00 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 3.20 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 3.20 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 3.20 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 3.20 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 2.40 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.40 |
COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.80 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.80 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.80 |
COG2845 | Peptidoglycan O-acetyltransferase, SGNH hydrolase family | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.40 % |
Unclassified | root | N/A | 33.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig540867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3595 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0619991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 533 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_11075602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 534 | Open in IMG/M |
3300000956|JGI10216J12902_100596409 | Not Available | 572 | Open in IMG/M |
3300000956|JGI10216J12902_102349017 | Not Available | 1133 | Open in IMG/M |
3300000956|JGI10216J12902_105557866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 784 | Open in IMG/M |
3300000956|JGI10216J12902_110377371 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300002568|C688J35102_120318460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. SCN 65-20 | 987 | Open in IMG/M |
3300003999|Ga0055469_10174878 | Not Available | 661 | Open in IMG/M |
3300004020|Ga0055440_10162908 | Not Available | 564 | Open in IMG/M |
3300004114|Ga0062593_101165227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 806 | Open in IMG/M |
3300004156|Ga0062589_100209518 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300004156|Ga0062589_102618309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300004157|Ga0062590_102643482 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300004463|Ga0063356_102560728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 783 | Open in IMG/M |
3300004479|Ga0062595_101921644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
3300005093|Ga0062594_101771547 | Not Available | 649 | Open in IMG/M |
3300005169|Ga0066810_10058317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300005172|Ga0066683_10110961 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
3300005332|Ga0066388_103103392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 849 | Open in IMG/M |
3300005332|Ga0066388_103919387 | Not Available | 759 | Open in IMG/M |
3300005338|Ga0068868_101970455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
3300005353|Ga0070669_101908267 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005354|Ga0070675_101209755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
3300005356|Ga0070674_102100365 | Not Available | 515 | Open in IMG/M |
3300005364|Ga0070673_101731679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
3300005459|Ga0068867_100250330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1440 | Open in IMG/M |
3300005535|Ga0070684_101183931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
3300005544|Ga0070686_100908761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 717 | Open in IMG/M |
3300005545|Ga0070695_101403841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
3300005719|Ga0068861_101534561 | Not Available | 654 | Open in IMG/M |
3300005981|Ga0081538_10064650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2068 | Open in IMG/M |
3300006049|Ga0075417_10669475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300006194|Ga0075427_10032845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 856 | Open in IMG/M |
3300006196|Ga0075422_10074936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1265 | Open in IMG/M |
3300006806|Ga0079220_10686431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300006844|Ga0075428_100821650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
3300006847|Ga0075431_100640041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1044 | Open in IMG/M |
3300006969|Ga0075419_10424124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 914 | Open in IMG/M |
3300009094|Ga0111539_11647000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 744 | Open in IMG/M |
3300009156|Ga0111538_10764781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1223 | Open in IMG/M |
3300010036|Ga0126305_10911712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300010038|Ga0126315_10661405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
3300010042|Ga0126314_10098121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1986 | Open in IMG/M |
3300010043|Ga0126380_10571327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
3300010358|Ga0126370_12086699 | Not Available | 556 | Open in IMG/M |
3300010359|Ga0126376_10902595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
3300010362|Ga0126377_11591030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
3300010375|Ga0105239_11561727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
3300011119|Ga0105246_10063502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 2576 | Open in IMG/M |
3300011412|Ga0137424_1087392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
3300012901|Ga0157288_10104054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300012908|Ga0157286_10035499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1197 | Open in IMG/M |
3300012914|Ga0157297_10440967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 533 | Open in IMG/M |
3300012961|Ga0164302_11108194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300012961|Ga0164302_11205699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 605 | Open in IMG/M |
3300012984|Ga0164309_11202916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 636 | Open in IMG/M |
3300012989|Ga0164305_10986690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300013296|Ga0157374_10843407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 933 | Open in IMG/M |
3300014270|Ga0075325_1206125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300014326|Ga0157380_12827482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300015200|Ga0173480_10504271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
3300015371|Ga0132258_11900028 | Not Available | 1499 | Open in IMG/M |
3300015372|Ga0132256_101473514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300015372|Ga0132256_101988632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
3300015372|Ga0132256_103228629 | Not Available | 548 | Open in IMG/M |
3300015373|Ga0132257_100186607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2450 | Open in IMG/M |
3300015373|Ga0132257_100802547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1175 | Open in IMG/M |
3300015373|Ga0132257_103914027 | Not Available | 542 | Open in IMG/M |
3300015374|Ga0132255_103295291 | Not Available | 688 | Open in IMG/M |
3300017792|Ga0163161_10208622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1508 | Open in IMG/M |
3300017965|Ga0190266_10044539 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300017965|Ga0190266_10110948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
3300018052|Ga0184638_1174168 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300018072|Ga0184635_10037572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1841 | Open in IMG/M |
3300018466|Ga0190268_11303551 | Not Available | 613 | Open in IMG/M |
3300018469|Ga0190270_11421944 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300018481|Ga0190271_13084446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
3300018482|Ga0066669_11358830 | Not Available | 643 | Open in IMG/M |
3300018920|Ga0190273_11110240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300023168|Ga0247748_1059021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
3300025925|Ga0207650_11864056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
3300025926|Ga0207659_11708593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
3300025929|Ga0207664_11191668 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300025935|Ga0207709_11166810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300025942|Ga0207689_11482734 | Not Available | 567 | Open in IMG/M |
3300025961|Ga0207712_11810433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
3300026067|Ga0207678_11142000 | Not Available | 690 | Open in IMG/M |
3300027743|Ga0209593_10171311 | Not Available | 773 | Open in IMG/M |
3300027909|Ga0209382_10938796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
3300027915|Ga0209069_10774575 | Not Available | 570 | Open in IMG/M |
3300028589|Ga0247818_10749390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella mangrovi | 679 | Open in IMG/M |
3300028717|Ga0307298_10065761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1006 | Open in IMG/M |
3300028814|Ga0307302_10709501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300030336|Ga0247826_11425803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300031170|Ga0307498_10041191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1200 | Open in IMG/M |
3300031908|Ga0310900_11011409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300031995|Ga0307409_101451977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
3300032000|Ga0310903_10508055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
3300032013|Ga0310906_10645963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300032893|Ga0335069_12456086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 540 | Open in IMG/M |
3300033551|Ga0247830_11056151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 648 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.20% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.40% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.40% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.80% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_14258260 | 2124908045 | Soil | VQNYEVGMEGSTPKRELLIPIRTILVVSAAIGVLGAFVAIGSTFLIVFVGIFLGLVFE |
ICChiseqgaiiDRAFT_06199911 | 3300000033 | Soil | MNGVGKRRVELLIPMRTLLLVAAAIGVLAAFVAIGDTFLIVFVG |
ICChiseqgaiiFebDRAFT_110756021 | 3300000363 | Soil | VPSDRGSYSSPVSAPEKRRTEILIPVRTLLLVAAAVGVGIAFRAIGDTFLIVFVGIF |
JGI10216J12902_1005964092 | 3300000956 | Soil | MNPGGARRIELLVPMRTIVIVGAAIAVGLAFRAIGDTFLIVFVGIFLAL |
JGI10216J12902_1023490171 | 3300000956 | Soil | MEPHEPKRMALLLPMRTLLVVGAAVALGLAFVAIGETFLIVFVGIFLALVFE |
JGI10216J12902_1044185781 | 3300000956 | Soil | MESSIPKRALIVPIRTILVVSAAIGVLGAFVAIGSTFLIVFVGIFLGLVF |
JGI10216J12902_1049524221 | 3300000956 | Soil | MAGQVEKRELIIPIRTILVVSAAIGVLGAFVAIGDTFLIVFIGIFLGLVFE |
JGI10216J12902_1055578662 | 3300000956 | Soil | VRTSNTCGVNEGQSRRIELILPMRTILLVAATAMVLAAFAAIGDTFLIVFVGIFLAL |
JGI10216J12902_1103773711 | 3300000956 | Soil | MNGVGKRRVELLIPMRTLLLVAAAIGVLAAFVAIGDTFLIVFVGI |
JGI10216J12902_1175263871 | 3300000956 | Soil | MADQPAKRELIIPIRTILIVSAAIGVLGAFVAIGSTFLIVFVGIFLGLVF |
C688J35102_1203184602 | 3300002568 | Soil | MEEAPRRRVELYLPMRTLLIVAAAIAVMAAFVSIGDTFLIVFVGIFLAL |
Ga0055469_101748781 | 3300003999 | Natural And Restored Wetlands | VELLVPMRTVLVIAGAILVLAAFATIGDTFLIVFIGIFLGLVFE |
Ga0055440_101629081 | 3300004020 | Natural And Restored Wetlands | MESESARRVELLIPLRTLLLVAAAAGVIAAFRSIGDVFLIVFVGIFL |
Ga0062593_1011652272 | 3300004114 | Soil | MNEAQPRRIELMLPMRTVLLVAATVGVLAALASIGDTFLVVFIGIFL |
Ga0062589_1002095181 | 3300004156 | Soil | MESDQARRVELLVPVRTLVVVAAALGLIAAFWAIGDTFLIVFVGIFL |
Ga0062589_1026183092 | 3300004156 | Soil | MESPAERRVELLIPMRTLLLVLGALGLAVAFAAIGDTFLIVFVGIFL |
Ga0062590_1026434821 | 3300004157 | Soil | MNEAEPRTVSLLLPMRTVLLVAAATGVLLAFWAIGDTFLIVFIGIFLAL |
Ga0063356_1025607281 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VEPAESRRVEIVLPMRTVLVVAAAIGLMVAFAAIGDTFLIVFVGIFLA |
Ga0062595_1019216441 | 3300004479 | Soil | MRTLLIVAAAIAVMAALVSIGDTFLIVFVGIFLALVFEYPVRF |
Ga0062594_1017715471 | 3300005093 | Soil | VEPRESRRVELLIPIRTLLIVFGAIAVMGAFVAIGSTFLIVFIGIFLGLVF |
Ga0066807_10401321 | 3300005161 | Soil | MAGSVKKRELLIPIRTILVVSAAIGVLGAFVAIGDTFLIVFIGI |
Ga0066810_100583173 | 3300005169 | Soil | MAGSVKKRELLIPIRTILVVSAAIGVLGAFVAIGDTFLIVFIGIFLALVFEYP |
Ga0066683_101109613 | 3300005172 | Soil | MDQTPKRRVEVLVPMRTLLVVAAAIAVMAAFVSIGDTFLIVFV |
Ga0066388_1031033922 | 3300005332 | Tropical Forest Soil | MQMPARRVELLLPIRTILVIGAAVAVFSAFRAIGDTFLIVFVGIFLALVFEYP |
Ga0066388_1039193872 | 3300005332 | Tropical Forest Soil | MSEGKPRRIELLLPIRTVLIVTATILLLAAFQAIGDTFLVVFVGIFLALVFE |
Ga0066388_1058186722 | 3300005332 | Tropical Forest Soil | MAEQAAKRELIIPIRTILIVSAAIGVLGAFVAIGDTFLIVFV |
Ga0068868_1019704551 | 3300005338 | Miscanthus Rhizosphere | MDRARKRRVELLLPMRTLLAVAATIGVLAAFVAIGDTFLIVFVG |
Ga0070669_1019082672 | 3300005353 | Switchgrass Rhizosphere | MDSRESRRVELVLPLRTVVLVVATIAVMAAFAAIGDTFLV |
Ga0070675_1012097551 | 3300005354 | Miscanthus Rhizosphere | MSDERRRTELLLPMRTVLLVAATIGVLAAFKEIGDTFLIVFVGIFLG |
Ga0070674_1021003651 | 3300005356 | Miscanthus Rhizosphere | MNDAEPRTVQLLLPMRTVLLVAAATGVLLAFWAIGDTFLI |
Ga0070673_1017316791 | 3300005364 | Switchgrass Rhizosphere | MRTLLLVLGALGLAVAFAAIGDTFLIVFVGIFLALVFEYPVRF |
Ga0068867_1002503301 | 3300005459 | Miscanthus Rhizosphere | VELVLPMRTVLLVAATAGVLAAFWAIGETFLVVFIGIFLALVFEYP |
Ga0070684_1011839311 | 3300005535 | Corn Rhizosphere | VNGERRRTELLLPMRTVLLVAATLGVLAAFREIGDTFLIVFVGIFL |
Ga0070686_1009087612 | 3300005544 | Switchgrass Rhizosphere | MESPAERRVELLIPMRTLLLVLGALGLAVAFAAIGDTFLIVFVGIFLALVFE |
Ga0070695_1014038412 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VELVLPMRTVLLVAATAGVLAAFWAIGETFLVVFIGIFLALVFEY |
Ga0066905_1000231917 | 3300005713 | Tropical Forest Soil | MAGAEKRELIIPIRTILIVSAAIGILGAFVAIGSTFLIVFVGIFLGL |
Ga0068861_1015345612 | 3300005719 | Switchgrass Rhizosphere | VSSGEKLRTEIIIPMRMVLLVAAAVGVGIAFRAIGDTFLIVFVGIF |
Ga0081538_100646501 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MDPVKTRRVELVLPMRTIILLVATVGVVAAFRAIGD |
Ga0075417_106694752 | 3300006049 | Populus Rhizosphere | MRTVLLVAAAAGVLAAFVAIGETFLIVFIGIFLALVFEY |
Ga0075427_100328451 | 3300006194 | Populus Rhizosphere | MSTPETRRVELLLPVRTLLLLALLVGLMVAFRAIGDTFLIVFIGVF |
Ga0075422_100749363 | 3300006196 | Populus Rhizosphere | MTEPRRTELLLPMRTVLLVAAAAGVLAAFVAIGETFLIVFIGI |
Ga0074055_117224532 | 3300006573 | Soil | MAGSVEKRELLIPVRTILIVSAAIGVLGAFVAIGDTFLIVFVGIFLGLVFE |
Ga0074053_100234551 | 3300006575 | Soil | MAGPAEKRELLIPIRTILIVSAAIGVLGAFVAIGD |
Ga0074050_120896591 | 3300006577 | Soil | MAGSVKKRELLIPIRTILVVSAAIGVLGAFVAIGDTFLIVF |
Ga0079220_106864311 | 3300006806 | Agricultural Soil | MSSPGERRVELLLPVRTIIVIGAAVAVFAAFEAIGSTFLIV |
Ga0075428_1008216501 | 3300006844 | Populus Rhizosphere | MRTVLLVAAAAGVLAAFVAIGETFLIVFIGIFLALVFEYPVRF |
Ga0075431_1006400411 | 3300006847 | Populus Rhizosphere | MRTVLLVAAAAGVLAAFVAIGETFLIVFIGIFLALVFEYPVRFLMAKT |
Ga0075419_104241241 | 3300006969 | Populus Rhizosphere | MRTVLLVAAAAGVLAAFVAIGETFLIVFIGIFLALVFEYPVRFL |
Ga0111539_116470001 | 3300009094 | Populus Rhizosphere | MDEPPKRRVELYLPIRTLLIVAAAVALMAAFVAIGDTFLIVFVGIFLGLV |
Ga0111538_107647811 | 3300009156 | Populus Rhizosphere | MTEPRRIELLLPMRTVLLVAAAAGVLAAFVAIGETFLIVFIGI |
Ga0075423_132242312 | 3300009162 | Populus Rhizosphere | MEAPERKRVELLLPMRTVLIVAAAVAVFAAFVAIGDTFLIVFIGIF |
Ga0105249_131052241 | 3300009553 | Switchgrass Rhizosphere | MAGPVEKREVLIPIRTILIVSAAIAVLGAFVAIGDTFLIVFVG |
Ga0126305_109117121 | 3300010036 | Serpentine Soil | MRAMGARRVELLLPVRTVLLVAAAVAVIAAFREIGDTFLIVFIGIF |
Ga0126315_106614052 | 3300010038 | Serpentine Soil | MDRARTRRVELLVPMRTLLVMAATIGVLAAFVAIG |
Ga0126314_100981211 | 3300010042 | Serpentine Soil | VEPRDTKRVELLIPIRTLLIVLGAIAVMGALVAIGSTFLIVFIGIFLG |
Ga0126380_105713271 | 3300010043 | Tropical Forest Soil | MEDSVPKRALIVPIRTILVVSAAIGVLGAFVAIGSTFLIVFVGIFLGLVFEFPVRFVIKR |
Ga0134065_101738811 | 3300010326 | Grasslands Soil | MEGSTPRRELLIPIRTIIVVSAAIGVLGAFVAIGSTFLIVFVGIFL |
Ga0126370_120866991 | 3300010358 | Tropical Forest Soil | MRTLLIVFAAIAVGAAFRAIGDTFLIVFVGIFLGFV |
Ga0126376_109025951 | 3300010359 | Tropical Forest Soil | VDPGGTRRIELLLPMRTIILVAATVGVIAAFRAIGDTFLIVFV |
Ga0126377_115910301 | 3300010362 | Tropical Forest Soil | MASDGTRRVELLVPVRTLIVVAAAIGVLAAFRTIGDTFLIVFVGIFLGLVFEFP |
Ga0126377_115979953 | 3300010362 | Tropical Forest Soil | MTDQTPKRELIIPIRTILIVSAAIGVLGAFVAIGDTFLIVFVGIFL |
Ga0126377_116125903 | 3300010362 | Tropical Forest Soil | MAEQAAKRELIIPIRTILIVSAAIGVLGAFVAIGDTFLIVFVGIFL |
Ga0105239_115617272 | 3300010375 | Corn Rhizosphere | MDEVPKRRVELLIPMRTLLLVAAAAAVAAAFIAIGDTFLIVFVGIFLALVF |
Ga0105246_100635023 | 3300011119 | Miscanthus Rhizosphere | VESRDTKRIELLLPIRTVLIAAAAIGVIFAFREIGSTFLIVFVGIFL |
Ga0137424_10873921 | 3300011412 | Soil | MTEPRRIELLLPMRTVLLVAATLGVLSAFVAIGDTFLIVFVGIFLAIVF |
Ga0157288_101040541 | 3300012901 | Soil | MRTVLIVAAAILILAAFAVIGESFLIVFVGIFLALVFEFPVRFVI |
Ga0157286_100354993 | 3300012908 | Soil | MRTVLIVAAAILILAAFAVIGESFLIVFVGIFLALVF |
Ga0157297_104409672 | 3300012914 | Soil | MEPAETRRRVELLLPVRTLFLVAAAIAIFGAFMAIGNTFLIVFVGIFL |
Ga0164302_111081941 | 3300012961 | Soil | MAEQAARRELIIPIRTILIVSAAIGVLGAFVAIGDTFLIVFVGIFLGL |
Ga0164302_112056992 | 3300012961 | Soil | MGAIGLMAAFAAIGDSFLIVFVGIFLALVFEYPTRFVMAKT |
Ga0164309_112029162 | 3300012984 | Soil | MDPAHNRRVELLLPMRTLLIIAAAIAVMAAFVAIGDTFLIVFI |
Ga0164305_109866901 | 3300012989 | Soil | MSDERRRTELLLPMRTVLLVAATIGVLAAFKEIGDTFLIVFVGIFLGLVFE |
Ga0157374_108434072 | 3300013296 | Miscanthus Rhizosphere | MRTVLLVAATLGVLAAFREIGDTFLIVFVGIFLGLVFEYPVRFVMLK |
Ga0075325_12061252 | 3300014270 | Natural And Restored Wetlands | MDPSSTKRVELVLPMRTVLLVAAAVGVATAFAVIGSTFLVVFVGIFLALVFEFP |
Ga0157380_128274821 | 3300014326 | Switchgrass Rhizosphere | MESPAERRVELLIPMRTLLLVLGALGLAVAFAAIGDTFLIVFVGIFLAL |
Ga0173480_105042711 | 3300015200 | Soil | MEPQPTKRVELYLPMRTVLIVAAAIVVLAAFAVIGDSFLIVFVGIFLALV |
Ga0134089_102899771 | 3300015358 | Grasslands Soil | MAGSVEKRELLIPIRTILIVSAAIGVLGAFVAIGDTFLIVF |
Ga0132258_119000281 | 3300015371 | Arabidopsis Rhizosphere | MNGAGKRRVELLIPMRTLLVVAAAIGVLAAFVAIGDTFLI |
Ga0132256_1014735141 | 3300015372 | Arabidopsis Rhizosphere | MRTIILVAATVGIIAAFRAIGDTFLIVFVGIFLALVFEYPVRF |
Ga0132256_1019886321 | 3300015372 | Arabidopsis Rhizosphere | MDQGGTRRIELLLPMRTIILLAATAGLLVAFKAIGDTFLIVFVG |
Ga0132256_1032286292 | 3300015372 | Arabidopsis Rhizosphere | MENGGTRRIELLLPMRTIILLAATVGVLAAFRAIGDTFLIVFVGI |
Ga0132257_1001866076 | 3300015373 | Arabidopsis Rhizosphere | MESAGSRRVELFVPVRTLLVVGAAVAVAAAFKAIGDTFLIVFIGIFLALVFE |
Ga0132257_1008025473 | 3300015373 | Arabidopsis Rhizosphere | MDPARNRRVELLLPMRTLLIIAAAIAVMAAFVAIGDTFLIVFIGVFLAL |
Ga0132257_1039140271 | 3300015373 | Arabidopsis Rhizosphere | MEVPERRRVDLYVPVRTLVVVAAAIAVLAAFQAIGDTFLIVFVGIFLAL |
Ga0132255_1032952912 | 3300015374 | Arabidopsis Rhizosphere | MENGGTRRIELLLPMRTIILLAATVGVLAAFRAIGDTFLIVFVGIFL |
Ga0163161_102086221 | 3300017792 | Switchgrass Rhizosphere | MSDERRRTELLLPMRTVLLVAATIGVLAAFKEIGDTFL |
Ga0190266_100445393 | 3300017965 | Soil | MESPEPRRIELLLPMRTVIVVAAAIALMAAFAAIGDTFLIVFIGIFLAFVFE |
Ga0190266_101109481 | 3300017965 | Soil | MEPAESRRVELILPMRTVIVVAAAIGLMVAFAAIGDTFLIVFIGIFLAFV |
Ga0184638_11741681 | 3300018052 | Groundwater Sediment | MESRDSRRVELVLPLRTVVLVVATLSVMVAFAAIGDTFLLVFVGIFL |
Ga0184635_100375723 | 3300018072 | Groundwater Sediment | MEAQSSPKRVELFIPLRTILLVAAAIAVMAAFVAIADAFLIVFVGIFLALVF |
Ga0184625_102164731 | 3300018081 | Groundwater Sediment | MAGQVEKRELIIPIRTILVVSAAIGVLGAFVAIGDTFLIVFVGIF |
Ga0190268_113035511 | 3300018466 | Soil | MESPEPRRIELLLPMRTVIVVAAAIALMAAFAAIGDTFLIVFIGIF |
Ga0190270_114219441 | 3300018469 | Soil | MESRESRRLELLLPLRTVVLVVAAIAVMAAFAAIGDTFLLV |
Ga0190271_130844461 | 3300018481 | Soil | MNGEGRRVELLLPMRTVLLVAATLGVLAAFREIGDT |
Ga0066669_113588302 | 3300018482 | Grasslands Soil | MRTLLIVGAAIALGAAFVSIGDTFLIVFVGIFLALVFESPVRFVIART |
Ga0066669_115781072 | 3300018482 | Grasslands Soil | MEGSTPRRELLIPIRTIIVVSAAIGVLGAFVAIGSTFLIVFV |
Ga0190273_111102401 | 3300018920 | Soil | MEPAESRRVELILPMRTVIVVAAAIGLMAAFAAIGDTFLIVFIGI |
Ga0193697_11329351 | 3300020005 | Soil | MAGQVEKRELLIPIRTILVVSAAIGILGAFVAIGDTFLIVFVGIFLGLVFE |
Ga0247748_10590212 | 3300023168 | Soil | VPVRTLLVVSATIGLLAAFVAIGDTFLIVFVGIFLALVFEYPVRFV |
Ga0207650_118640562 | 3300025925 | Switchgrass Rhizosphere | VNGERRRTELLLPMRTVLLVAATIGVLAAFKEIGDTFLIVFVGI |
Ga0207659_117085932 | 3300025926 | Miscanthus Rhizosphere | MSDERRRTELLLPMRTVLLVAATIGVLAAFKEIGDTFLIVFVGIFLGLVF |
Ga0207664_111916681 | 3300025929 | Agricultural Soil | MRTVLLVAAAAAVLAAFVAIGDTFLIVFVGIFLGLVFE |
Ga0207709_111668102 | 3300025935 | Miscanthus Rhizosphere | MRTVLLVAATLGVLAAFVAIGDTFLIVFVGIFLGLV |
Ga0207689_114827341 | 3300025942 | Miscanthus Rhizosphere | LLLPMRTLLAVAATIGVLAAFVAIGDTFLIVFVGIFLALVFEYPV |
Ga0207712_118104331 | 3300025961 | Switchgrass Rhizosphere | MSDERRRTELLLPMRTVLLVAATLGVLAAFREIGDTFLIVFVG |
Ga0207678_111420001 | 3300026067 | Corn Rhizosphere | MSDERRRTELLLPMRTVLLVAATIGVLAAFKEIGDTFLIVFVGIFLGLVFEYP |
Ga0209593_101713111 | 3300027743 | Freshwater Sediment | MEPPEHMNAGGARRVELLLPMRTVLLVAATAGVLAAFWAIGDTFLVI |
Ga0209382_109387963 | 3300027909 | Populus Rhizosphere | MRTVLLVAAAAGVLAAFVAIGETFLIVFIGIFLALVF |
Ga0209069_107745752 | 3300027915 | Watersheds | MRTLLLVAAAILVLAAFWKIGDTFLIVFVGIFMGLVFEYPVRFVMKKTHWGRGLAAT |
Ga0247818_107493902 | 3300028589 | Soil | MDPVGTRRVELVLPMRTILLVGAAVAVFAAFKAIGSTFLIVFVGIFLALV |
Ga0307298_100657613 | 3300028717 | Soil | MESPAERRVELLLPMRTLLLVLGVIGLAVAFAAIGDTFLIVFVGIFLALVF |
Ga0307317_102616042 | 3300028720 | Soil | MAGQVEKRELLIPIRTILVVSAAIGVLGAFVAIGDTFLIVFVGIFLGLV |
Ga0307299_102366381 | 3300028793 | Soil | MSVMEPHRPKRVELLLPVRTVLVIGAAIAVMGAFVAIGDTFLLVFVGI |
Ga0307284_100127301 | 3300028799 | Soil | MDAPPSKRVELLLPIRTVLILVGAIAIMAAFKAIGDTFLVV |
Ga0307302_101156063 | 3300028814 | Soil | MAGQVEKRELLIPIRTILVVSAAIGVLGAFVAIGDT |
Ga0307302_107095012 | 3300028814 | Soil | VTSVDPTAPKRVELLLPMRTLLLIAAAVGVIAAFQAIGDTFLIVFVGI |
Ga0307312_109749392 | 3300028828 | Soil | MAGQVEKRELLIPIRTILVVSAAIGVLGAFVAIGDTFLIVFIGI |
Ga0247826_114258031 | 3300030336 | Soil | MDRARKRRVELLLPMRTLLAVAATIGVLAAFVAIGDTFLIV |
Ga0307498_100411913 | 3300031170 | Soil | MDPGGTRRIELLLPMRTIILVAATIGVFGAFRAIGDTFLIVFVGIFLA |
Ga0310900_110114091 | 3300031908 | Soil | MRTVLIVAATIGVLAAFVAIGDTFLIVFIGIFLALVFEYPVRFLMSKTNFSRGVAAAV |
Ga0307409_1014519772 | 3300031995 | Rhizosphere | MRTLLVMAATIGVLAAFVAIGDTFLIVFVGIFLALVFEYPVRFVMRKTHMS |
Ga0310903_105080552 | 3300032000 | Soil | LLLPMRTLLAVAATIGVLAAFVAIGDTFLIVFVGIFLALVFEYP |
Ga0310906_106459633 | 3300032013 | Soil | MEPHPTKRVELYLPMRTVLIVAAAILILAAFAVIGESFLIV |
Ga0335069_124560861 | 3300032893 | Soil | VNPTRGRRIELLIPMRTLLLVAAAVAVLAALMEIGDTFLVVFVGIFLG |
Ga0247830_110561511 | 3300033551 | Soil | VESRESRRTELILPMRTVLLVAAAIGVMVAFAAIGDTFLIVFVGIFLAFVFE |
⦗Top⦘ |