NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067961

Metagenome / Metatranscriptome Family F067961

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067961
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 49 residues
Representative Sequence VRYPVEIRKAPDIDEEMTRKVLGLIETDAALKAAVSGNPKIRSAVKG
Number of Associated Samples 108
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.00 %
% of genes near scaffold ends (potentially truncated) 94.40 %
% of genes from short scaffolds (< 2000 bps) 85.60 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.200 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.600 % of family members)
Environment Ontology (ENVO) Unclassified
(37.600 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.800 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.67%    β-sheet: 0.00%    Coil/Unstructured: 57.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF00365PFK 8.00
PF04879Molybdop_Fe4S4 6.40
PF04366Ysc84 4.80
PF07690MFS_1 3.20
PF05977MFS_3 2.40
PF01479S4 2.40
PF03631Virul_fac_BrkB 2.40
PF00330Aconitase 2.40
PF13240zinc_ribbon_2 2.40
PF09721Exosortase_EpsH 1.60
PF13620CarboxypepD_reg 1.60
PF05960DUF885 1.60
PF08032SpoU_sub_bind 0.80
PF00072Response_reg 0.80
PF13564DoxX_2 0.80
PF02239Cytochrom_D1 0.80
PF02472ExbD 0.80
PF07681DoxX 0.80
PF03781FGE-sulfatase 0.80
PF00839Cys_rich_FGFR 0.80
PF06434Aconitase_2_N 0.80
PF06831H2TH 0.80
PF13466STAS_2 0.80
PF07238PilZ 0.80
PF14384BrnA_antitoxin 0.80
PF13860FlgD_ig 0.80
PF01694Rhomboid 0.80
PF04389Peptidase_M28 0.80
PF00342PGI 0.80
PF13520AA_permease_2 0.80
PF00069Pkinase 0.80
PF02687FtsX 0.80
PF08240ADH_N 0.80
PF12697Abhydrolase_6 0.80
PF00384Molybdopterin 0.80
PF03699UPF0182 0.80
PF00326Peptidase_S9 0.80
PF13185GAF_2 0.80
PF13628DUF4142 0.80
PF00311PEPcase 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 8.00
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 4.80
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.20
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.40
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 2.40
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 1.60
COG0166Glucose-6-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.80
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.80
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.80
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.80
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 0.80
COG1049Aconitase BEnergy production and conversion [C] 0.80
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.80
COG1615Uncharacterized membrane protein, UPF0182 familyFunction unknown [S] 0.80
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.80
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 0.80
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.20 %
UnclassifiedrootN/A20.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459014|G1P06HT01B5DGPAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis706Open in IMG/M
3300001170|JGI12704J13340_1005236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis1249Open in IMG/M
3300001305|C688J14111_10098138Not Available892Open in IMG/M
3300002245|JGIcombinedJ26739_100151956All Organisms → cellular organisms → Bacteria2188Open in IMG/M
3300004092|Ga0062389_101336923All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300004101|Ga0058896_1433005Not Available571Open in IMG/M
3300004114|Ga0062593_100055020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2514Open in IMG/M
3300004156|Ga0062589_100846416All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300005184|Ga0066671_10641929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae689Open in IMG/M
3300005344|Ga0070661_101809676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43518Open in IMG/M
3300005436|Ga0070713_100923075All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005436|Ga0070713_100958686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae824Open in IMG/M
3300005458|Ga0070681_11322325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae644Open in IMG/M
3300005526|Ga0073909_10686836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia512Open in IMG/M
3300005529|Ga0070741_10681633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae909Open in IMG/M
3300005531|Ga0070738_10346750Not Available603Open in IMG/M
3300005537|Ga0070730_10956470All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005538|Ga0070731_10568701All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005591|Ga0070761_10094655All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300005591|Ga0070761_10950555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae544Open in IMG/M
3300005610|Ga0070763_10884569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae531Open in IMG/M
3300005712|Ga0070764_10075729All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300005764|Ga0066903_101655831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1216Open in IMG/M
3300005921|Ga0070766_10061315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2141Open in IMG/M
3300005921|Ga0070766_10678924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae696Open in IMG/M
3300006175|Ga0070712_102022555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae504Open in IMG/M
3300006176|Ga0070765_101046296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300006854|Ga0075425_103019854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia514Open in IMG/M
3300006893|Ga0073928_10948894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae588Open in IMG/M
3300009518|Ga0116128_1155155All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300009623|Ga0116133_1000542All Organisms → cellular organisms → Bacteria11833Open in IMG/M
3300009645|Ga0116106_1155304All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300010043|Ga0126380_10664929All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300010048|Ga0126373_12331374All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010048|Ga0126373_13318357Not Available501Open in IMG/M
3300010358|Ga0126370_11156877All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300010376|Ga0126381_100218585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2560Open in IMG/M
3300010398|Ga0126383_11672461All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012469|Ga0150984_121974972Not Available507Open in IMG/M
3300012948|Ga0126375_10437477Not Available957Open in IMG/M
3300014201|Ga0181537_10492581All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300014498|Ga0182019_10787775Not Available679Open in IMG/M
3300015372|Ga0132256_100014586All Organisms → cellular organisms → Bacteria6865Open in IMG/M
3300016270|Ga0182036_11619783Not Available545Open in IMG/M
3300016357|Ga0182032_10818751Not Available788Open in IMG/M
3300016387|Ga0182040_11371069Not Available598Open in IMG/M
3300016750|Ga0181505_10219934Not Available1580Open in IMG/M
3300017943|Ga0187819_10661568All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300017959|Ga0187779_10194293All Organisms → cellular organisms → Bacteria → Acidobacteria1268Open in IMG/M
3300017972|Ga0187781_10412053All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300017993|Ga0187823_10322605All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018030|Ga0187869_10606038Not Available518Open in IMG/M
3300018034|Ga0187863_10111235All Organisms → cellular organisms → Bacteria → Acidobacteria1532Open in IMG/M
3300018038|Ga0187855_10452303All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300018042|Ga0187871_10078080Not Available1935Open in IMG/M
3300018042|Ga0187871_10193009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1140Open in IMG/M
3300020581|Ga0210399_11341406Not Available561Open in IMG/M
3300020582|Ga0210395_10598463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium828Open in IMG/M
3300021181|Ga0210388_10053439All Organisms → cellular organisms → Bacteria → Acidobacteria3372Open in IMG/M
3300021181|Ga0210388_10530762All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300021181|Ga0210388_10731274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300021181|Ga0210388_11498582Not Available563Open in IMG/M
3300021181|Ga0210388_11736540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola515Open in IMG/M
3300021404|Ga0210389_11376236Not Available539Open in IMG/M
3300021407|Ga0210383_10125949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2167Open in IMG/M
3300021407|Ga0210383_11081799Not Available678Open in IMG/M
3300021420|Ga0210394_10073213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2966Open in IMG/M
3300021433|Ga0210391_10301410All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300021445|Ga0182009_10686749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae553Open in IMG/M
3300021475|Ga0210392_11364741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola530Open in IMG/M
3300021477|Ga0210398_10302784All Organisms → cellular organisms → Bacteria → Acidobacteria1304Open in IMG/M
3300021559|Ga0210409_11580142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae532Open in IMG/M
3300021560|Ga0126371_13211000Not Available553Open in IMG/M
3300021560|Ga0126371_13326937All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300022531|Ga0242660_1027050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1129Open in IMG/M
3300022557|Ga0212123_10041782Not Available4395Open in IMG/M
3300022557|Ga0212123_10644705All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300022840|Ga0224549_1015840All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300025412|Ga0208194_1001480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4810Open in IMG/M
3300025912|Ga0207707_10013937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7009Open in IMG/M
3300025912|Ga0207707_10672828All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300025915|Ga0207693_10821656All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300025928|Ga0207700_11137290All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300025929|Ga0207664_11240317All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300025945|Ga0207679_11741255All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027376|Ga0209004_1073177Not Available579Open in IMG/M
3300027505|Ga0209218_1058874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae781Open in IMG/M
3300027545|Ga0209008_1016065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1756Open in IMG/M
3300027676|Ga0209333_1103710All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300027829|Ga0209773_10263226Not Available720Open in IMG/M
3300027842|Ga0209580_10671904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300027853|Ga0209274_10585394All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300027853|Ga0209274_10731360All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300027869|Ga0209579_10290652All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300027879|Ga0209169_10715738Not Available518Open in IMG/M
3300027889|Ga0209380_10596673All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027895|Ga0209624_10340695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae999Open in IMG/M
3300027908|Ga0209006_10067468All Organisms → cellular organisms → Bacteria3191Open in IMG/M
3300027908|Ga0209006_11041431All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300028783|Ga0302279_10390787All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300028873|Ga0302197_10482447Not Available542Open in IMG/M
3300028906|Ga0308309_11099055All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300029910|Ga0311369_10363932All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300029911|Ga0311361_10512818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1188Open in IMG/M
3300029953|Ga0311343_11360493All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300029954|Ga0311331_10080152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4299Open in IMG/M
3300029999|Ga0311339_10118054All Organisms → cellular organisms → Bacteria3213Open in IMG/M
3300030020|Ga0311344_10456412All Organisms → cellular organisms → Bacteria → Acidobacteria1150Open in IMG/M
3300030053|Ga0302177_10561010All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031057|Ga0170834_104715563All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300031525|Ga0302326_12125201Not Available720Open in IMG/M
3300031708|Ga0310686_101089471All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031708|Ga0310686_113136683All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031715|Ga0307476_10220313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1381Open in IMG/M
3300031715|Ga0307476_10746771Not Available724Open in IMG/M
3300031753|Ga0307477_10040129All Organisms → cellular organisms → Bacteria → Acidobacteria3215Open in IMG/M
3300031754|Ga0307475_10701371All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300032180|Ga0307471_101867463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia751Open in IMG/M
3300032515|Ga0348332_13216340All Organisms → cellular organisms → Bacteria2587Open in IMG/M
3300032562|Ga0316226_1066983All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300032783|Ga0335079_10001888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24008Open in IMG/M
3300032805|Ga0335078_11138580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae908Open in IMG/M
3300032897|Ga0335071_10591842All Organisms → cellular organisms → Bacteria → Acidobacteria1061Open in IMG/M
3300033289|Ga0310914_11440044All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300033475|Ga0310811_11258135Not Available598Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil9.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.20%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.80%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.20%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.20%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.40%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.40%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.40%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.80%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.80%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.80%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.80%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.80%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.80%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.80%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300001170Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2EnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004101Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2PV_034747602170459014Switchgrass, Maize And Mischanthus LitterLQFAEGGLELLVRYPVEIRRAPDIDEEMTRTVLQLVETDAELKTAVSGTPKIRSAIKG
JGI12704J13340_100523623300001170Forest SoilVRYPVEIRKAPEIDEEMTRKVLDLIETDAELKAAVAGNPKIRSTVKG*
C688J14111_1009813813300001305SoilLRRAPDIDEEMTRAVLELINTDEGLKRAVAGTPKIRSAIKG*
JGIcombinedJ26739_10015195613300002245Forest SoilPVEIRKAPDIDEEMTRKVLDLIETDEALKGAVSGNPKIRSAVKG*
Ga0062389_10133692313300004092Bog Forest SoilRYPVEIRSAPDIDDEMTRKVLDMIETDAALKTAVSGTPKIRSAVKG*
Ga0058896_143300513300004101Forest SoilGLELMIRYPVEIRRAPDTDEEMTRRVLDLISKDETLKAAVSGIPKIRSPIRG*
Ga0062593_10005502033300004114SoilYPVEIRRAPDIDEEMTRTVLQLIESDAELKTAVSGTPKIRSAIKG*
Ga0062589_10084641613300004156SoilLLVRYPVEIRKAPDTDEEMTRRVLHLVESDEVVKTAVSGTPKIRSAIKG*
Ga0066671_1064192923300005184SoilRYPVEIRRAPDIDEEMTRTVLQLIESDAELKTAVSGTPKIRSAIKG*
Ga0070661_10180967613300005344Corn RhizosphereVRYPVEIRKAPDTDEEMTWRVLHLVESDEVVKTAVSGTPKIRS
Ga0070713_10092307513300005436Corn, Switchgrass And Miscanthus RhizosphereQFADDGLELLVRYPVEIRRAPDTDEEMTQRVLDLIAKDESVKSAVSGMPKIRSAIRG*
Ga0070713_10095868613300005436Corn, Switchgrass And Miscanthus RhizosphereRRAPDIDEEMTRKVLQLIENDAALKTAVSGLPKIRSAIKG*
Ga0070681_1132232513300005458Corn RhizosphereRRAPDIDEEMTRTVLQLIESDVELKTAVSGTPKIRSAIKG*
Ga0073909_1068683613300005526Surface SoilEIRRAPGTDEDMTRRVLDLIAKDETLKAAVSGIPKIRSAIRG*
Ga0070741_1068163313300005529Surface SoilLQFADAGLELLVRYPVELRSAPDIDEQMTRTVLNLVTNDQDLKTAVSGTPKIRSAIKG*
Ga0070738_1034675013300005531Surface SoilRLQFADAGLELLVRYPVELRRAPDIDERMTRTVLELISTDESLKSAVSGTPKIRSAIKG*
Ga0070730_1095647013300005537Surface SoilAGLELLVRYPVEIRRAPDTDEEMTRKVHELIETDAGLKASVSGTPKIRSAIKG*
Ga0070731_1056870123300005538Surface SoilIDEEMTRKVLQLIETDAGLKTAVSGTPRIRSAVKM*
Ga0070761_1009465533300005591SoilVEIRKAPDIDEEMTRKVLHLIETDEALKAAVSGNPKIRSAVKG*
Ga0070761_1095055513300005591SoilLELLVRYPVEIRKAPDIDEEMTRKVLALIETDAALKAAVSGTPKIRSAIKG*
Ga0070763_1088456923300005610SoilLLVRYPVEIRKAPEIDEEMTRKVLDLIETDPELKAAVAGNPKIRSTVKG*
Ga0070764_1007572933300005712SoilPDIDEEMTRKVLDLIETDEALKGAVSGIPKIRSAVKG*
Ga0066903_10165583113300005764Tropical Forest SoilLELLVRYPVEIRKAPDIDEEMTRKVPALIETDTALKAAVLGNPKIRSAVKG*
Ga0070766_1006131553300005921SoilKAPDIDEEMTRKVLHLIETDEALKAAVSGNPKIRSAVKG*
Ga0070766_1067892423300005921SoilPEARLQFADAGLELLVRYPVEIRNAPDIDEEMTRKVLELIGTDATLKAAVTGTPRIRSAIKG*
Ga0070712_10202255523300006175Corn, Switchgrass And Miscanthus RhizospherePVEIRRAPDIDEEMTRTVLQLIESDAELKTAVSGTPKIRSAIKG*
Ga0070765_10104629623300006176SoilAPDIDEEMTRKVLELIESDGGLKAVVSGVPKIRSAVKG*
Ga0075425_10301985423300006854Populus RhizosphereLELLVRYPVEIRRAPNTDEDMTRRVLDLIAKDETLKAAVSGIPKIRSAIRG*
Ga0073928_1094889413300006893Iron-Sulfur Acid SpringRAPDIDEEMTRKVLELIETDAGLKAAVAGTPKIRSAVKG*
Ga0116128_115515523300009518PeatlandVGLELRVRYPVELRKAPDVDEEMTRKVLELIETDAVLKAAVSGTPKIRSAVKG*
Ga0116133_1000542123300009623PeatlandEARLQFADVGLELRVRYPVELRKAPDVDEEMTRKVLELIETDAVLKAAVSGTPKIRSAVKG*
Ga0116106_115530423300009645PeatlandVELRKAPDVDEEMTRKVLELIETDAVLKAAVSGTPKIRSAVKG*
Ga0126380_1066492913300010043Tropical Forest SoilRAPDIDEEMTRRVLQLIETDEDLKKAVLGSPKIRSAIKG*
Ga0126373_1233137413300010048Tropical Forest SoilGLELLVRYPVEIRRAPGTDEEMTQRVLDLMAKDEAVKAAVSGTPKIRSAIRG*
Ga0126373_1331835713300010048Tropical Forest SoilLLVRYPVEIRRAPDIDEEMTQSVLDLVENDPVMKAATAGTPKIRTVVKG*
Ga0126370_1115687723300010358Tropical Forest SoilPDTEEEMTRRVVDLIAKDESVKTAVSGTPKIRSAIRG*
Ga0126381_10021858513300010376Tropical Forest SoilAPDIDEEMTRHVLELIDTDQGLKSAVSGTPKIRSAIKG*
Ga0126383_1167246113300010398Tropical Forest SoilRYPVEIRRAPDTDEEMTQKVLDLIARDEAVKAAVSGTPKIRSAIRG*
Ga0150984_12197497213300012469Avena Fatua RhizosphereRLRFADAGLELLVRYPVEIRRAPDTDEEMTRKVLDLIEKDAELKAAVSGVPKIRSAIKG*
Ga0126375_1043747723300012948Tropical Forest SoilELLVRYPVEIRTAPDTDEEMTRRVLDLISKDETLKSAVSGTPKIRSAIRG*
Ga0181537_1049258113300014201BogKAPDIDEEMTRKVLDLIETDQALKAAVSGNPKIRSAVKG*
Ga0182019_1078777523300014498FenEGGLELLVRYPVALRKGTDMDEQVTRKVLGLIASDPELKAVVSGAPKIRSPLKG*
Ga0132256_100014586103300015372Arabidopsis RhizosphereGLELLVRYPVEIRKAPDTDEEMTRRVLHLVESDEVVKTAVSGTPKIRSAIKG*
Ga0182036_1161978323300016270SoilAGLELLVRYPVEIRKAPDIDEEMTRKVLELIETDAALKAAVSGNPKIRSAVKG
Ga0182032_1081875123300016357SoilGYPDRGTAAEARLQFADAGLELLVRYPVEIRKAPDIDEEMTIKVLALIEADAALKAAVSGNPKIRSAVKG
Ga0182040_1137106913300016387SoilQFADAGLELLVRYPVEIRKAPDIDEEMTRKVLELIETDAALKAAVSGNPKIRSAVKG
Ga0181505_1021993433300016750PeatlandVRYPVEIRKAPDIDEEMTRKVLDLIETDEALKAAVSGNPKIRSAV
Ga0187819_1066156813300017943Freshwater SedimentEIRRAPDIDEEMTRRVLQLIETDESLKTAVSGTPKIRSAIKG
Ga0187779_1019429313300017959Tropical PeatlandLELLVRYPVEIRRAPDIDEEMTRRVLELIETDENLKMAVSGCPKIRSAIKG
Ga0187781_1041205333300017972Tropical PeatlandDIDEEMTRKVLALIETDGELKAAVSGSPKIRSAVKG
Ga0187823_1032260513300017993Freshwater SedimentDTDEEMTRKVLALIETDTELKAAVSGIPKIRSAVKG
Ga0187869_1060603813300018030PeatlandVGLELLVRYPVELRKAPDVDEEMTRKVLELIETDAVLKAAVSGTPKIRSAVKG
Ga0187863_1011123533300018034PeatlandFADAGLELLVRYPVEIRKAPDIDEEMTRKVLELIETDAALKAAVAGTPKIRSAVKG
Ga0187855_1045230313300018038PeatlandLELLVRYPVEIRRAPDIDEEMTRKVLELVETDAALKANITGSPKIRSAVKG
Ga0187871_1007808033300018042PeatlandRNAPDIDEEMTRKVLELIETDAAAKSAVSGTPKIRSAVKG
Ga0187871_1019300923300018042PeatlandGLELLVRYPVEIRKAPDIDEQMTRKVLELIETDAALKAAVSGIPKIRSAVKG
Ga0210399_1134140623300020581SoilIRNAPDTDEEMTRKVLELIETDAALKAAVSGTPKIRSAVKG
Ga0210395_1059846313300020582SoilLVRYPVEIRNAPDIDEEMTRKVLELVETDGGLKAVVSGLPKIRSAVKG
Ga0210388_1005343913300021181SoilQFADAGLELLVRYPVEIRKAPDVDEEMTRKVLDLIETDEALKAAVSGNPKIRSAVKG
Ga0210388_1053076233300021181SoilQFADTGLELIVRYPVEIRKAPDIDEQMTRKVLDLVENDATLKTAVTGNPKIRSAVKG
Ga0210388_1073127433300021181SoilVRYPVEIRNAPDTDEKMTRKVLELIETDAALKAAVSGTPKIRSAVKG
Ga0210388_1149858213300021181SoilLELLVRYPVEIRKAPDIDEEMTRKVLDLIETDEALKGAVSGIPKIRSAVKG
Ga0210388_1173654013300021181SoilEARLQFADAGLELLVRYPVEIREAPDIDEEMTRKVLDLIETDEAPKAAVSGNPKIRSAVK
Ga0210389_1137623613300021404SoilAGLELLVRYPVEIRKAPDIDEEMTRKVLQLIESDESLKAAVEGTPKIRSAVKG
Ga0210383_1012594943300021407SoilAGLELLVRYPVEIRKAPDVDEEMTRKVLDLIETDEALKAAVSGNPKIRSAVKG
Ga0210383_1108179913300021407SoilVEIRNAPDTDEKMTRKVLELIETDAALKAAVSGTPKIRSAVKG
Ga0210394_1007321313300021420SoilAGLELLVRYPVEIRNAPDTDEEMTRKVLELIETDAALKAAVSGTPKIRSAVKG
Ga0210391_1030141013300021433SoilLELLVRYPVEIRKAPDVDEEMTRKVLDLIETDEALKAAVSGNPKIRSAVKG
Ga0182009_1068674913300021445SoilDGGLELLVRYPVEIRRAPDIDEEMTRTVLQLVETDAELKAAVSGTPKIRSAIKG
Ga0210392_1136474113300021475SoilEARLQFADPGLELLVRYPVEIRTAPDIDEEMTRKVLELIETDSTLKASVAGNPKIRSAVK
Ga0210398_1030278433300021477SoilPVEIRNAPDIDEEMTRKVLELIETDAALKAAVSGTPKIRSAVKG
Ga0210409_1158014213300021559SoilFADGGLELLVRYPVEIRNAPDIDEEMTRKVLELVETDGGLKAVVSGLPKIRSAVKG
Ga0126371_1321100013300021560Tropical Forest SoilRRAPDIDEEMTRRVLELIETDEDLKKAVLGSPKIRSAIKG
Ga0126371_1332693713300021560Tropical Forest SoilLELLVRYPVDIRRAPDIDEEMTRKVLQLVQGDGDVKAAVSGTPKIRSAIKG
Ga0242660_102705033300022531SoilELMIRYPVEIRHAPDTDEEMTRRVLDLISKDETLKAAVSGIPKIRSPIRG
Ga0212123_1004178233300022557Iron-Sulfur Acid SpringIVRYPVEIRRAPDIDEEMTRRVLDLVENDAVLKAAVSGTPKIRSAVKG
Ga0212123_1064470523300022557Iron-Sulfur Acid SpringAPDIDEEMTRKVLELIETDAGLKAAVAGTPKIRSAVKG
Ga0224549_101584013300022840SoilELLVRYPVEIRRAPEIDDEMTRKVLELIETDAALKAAVSGSPKIRTAVKG
Ga0208194_100148013300025412PeatlandPEARLQFADVGLELRVRYPVELRKAPDVDEEMTRKVLELIETDAVLKAAVSGTPKIRSAVKG
Ga0207707_1001393783300025912Corn RhizosphereQFADGGLELLVRYPVEIRRAPDIDEEMTRTVLQLIESDAELKIAVSGTPKIRSAIKG
Ga0207707_1067282813300025912Corn RhizosphereIRRAPDIDEEMTRTVLQLIESDVELKTAVSGTPKIRSAIKG
Ga0207693_1082165613300025915Corn, Switchgrass And Miscanthus RhizosphereYPVEIRKAPDTDEEMTRNVLELIETDPELKAAVSGTPKIRSAVRG
Ga0207700_1113729023300025928Corn, Switchgrass And Miscanthus RhizosphereEIRRAPDIDEEMTRKVLQLIENDAALKTAVSGLPKIRSAIKG
Ga0207664_1124031713300025929Agricultural SoilVEIRRAPDVDEEMTRTVLDLVQKDAGLKAAVSGTPKIRSAIKG
Ga0207679_1174125523300025945Corn RhizosphereDIDEEMTRTVLQLIESDVELKTAVSGTPKIRSAIKG
Ga0209004_107317713300027376Forest SoilEIRNAPDTDEEMTRKVLELIETDAGMKAAVSGTPKIRSAVKG
Ga0209218_105887423300027505Forest SoilEARLQFADAGLELLVRYPVEIRKAPDIDEEMTRKVLDLIETDEALKGAVSGIPKIRSAVK
Ga0209008_101606533300027545Forest SoilARLQFADAGLELLVRYPVEIRKAPDIDEEMTRKVLDLIETDEALKGAVSGIPKIRSAVKG
Ga0209333_110371023300027676Forest SoilVEIRKAPDIDEEMTRKVLDLIETDEALKAAVSGNPKIRSAVKG
Ga0209773_1026322613300027829Bog Forest SoilIDEEMTRKVLQLIETDAALKASVSGTPKIRSAVKG
Ga0209580_1067190423300027842Surface SoilRAPDTDEEMTRKGLNLIETDAALKAAVSGTPKIRSAVKG
Ga0209274_1058539413300027853SoilVEIRKAPDIDEEMTRKVLHLIETDEALKAAVSGNPKIRSAVKG
Ga0209274_1073136023300027853SoilRKAPDIDEEMTRKVLALIETDAALKAAVSGTPKIRSAIKG
Ga0209579_1029065213300027869Surface SoilIDEEMTRKVLQLIETDAGLKTAVSGTPRIRSAVKM
Ga0209169_1071573823300027879SoilIRNAPDIDEEMTRKVLELIETDAAAKSAVSGTPKIRSAVKG
Ga0209380_1059667323300027889SoilEIRKAPDIDEEMTRKVLHLIETDEALKAAVSGNPKIRSAVKG
Ga0209624_1034069513300027895Forest SoilRPEARLQFADGGLELMVRYPVEIRNAPDIDEEMTRKVLELVETDGGLKAVVSGLPKIRSAVKG
Ga0209006_1006746843300027908Forest SoilLVRYPVEIRRAPDIDEEMTRKVLELIETDAGLKAAVAGTPKIRSAVKG
Ga0209006_1104143123300027908Forest SoilVDAGLELLVRYPVEIRKAPDIDEEMTRKVLQLIETDAALKAAVSGTPKIRSAVKG
Ga0302279_1039078723300028783BogAPRPEARVQFTDAGLELLVRYPVMLRKAPEVDERMTRSILALIETDPDLKAAVAGNPGIRAAVKG
Ga0302197_1048244713300028873BogRNAPDVDEEMTRKVLELIETDVALKAAVSGTPKIRSAVKG
Ga0308309_1109905513300028906SoilIRKAPDIDEEMTRKILDLIETDEALKAAVSGNPKIRSAVKG
Ga0311369_1036393223300029910PalsaYPVEIRKAPDIDEEMTRKVLDLIETDEALKAAVSGNPKIRSAVKG
Ga0311361_1051281833300029911BogLQFADTGLELLVRYPVEIRNAPDVDEEMTRKVLELIETDVALKAAVSGTPKIRSAVKG
Ga0311343_1136049323300029953BogEARVQFTDAGLELLVRYPVMLRKAPEVDERMTRSILALIETDPDLKAAVAGNPGIRAAVK
Ga0311331_1008015213300029954BogEARLQFADTGLELLVRYPVEIRNAPDVDEEMTRKVLELIETDVALKAAVSGTPKIRSAVK
Ga0311339_1011805413300029999PalsaAGLELLVRYPVEIRKAPDIDEEMTRKVLDLIETDEALKAAVSGNPKIRSAVKG
Ga0311344_1045641213300030020BogQAPRPEARVQFTDAGLELLVRYPVMLRKAPEVDERMTRSILALIETDPDLKAAVAGNPGIRAAVKG
Ga0302177_1056101013300030053PalsaPVEIRKAPDIDEEMTRKVLDLIETDEVLKAAVSGNPKIRSAVKG
Ga0170834_10471556323300031057Forest SoilPVEIRRAPDIDEEMTRKVLELIETDAGLKAAVAGTPKIRSAVKG
Ga0302326_1212520123300031525PalsaIQFADTGLELLVRYPVEIRKAPRIDEEMTRKVLELIETDATLKAAVSGTPKIRSAVKG
Ga0310686_10108947113300031708SoilLELLVRYPVEIRKAPDIDEEMTRKVLELIETDAALKASVAGIPKIRSAVKG
Ga0310686_11313668313300031708SoilIRKAPDIDEEMTRKVLQLIETDPALKAAVAGTPKIRSAVKG
Ga0307476_1022031313300031715Hardwood Forest SoilEIRRAPDTDEEMTRRVLDLISKDETLKAAVSGIPKIRSPIRG
Ga0307476_1074677113300031715Hardwood Forest SoilRYPVEIRNAPDTDEEMTRKVLELIETDAALKAAVSGTPKIRSAVKG
Ga0307477_1004012963300031753Hardwood Forest SoilGGLELMIRYPVEIRRAPDTDEEMTRRVLDLISKDETLKAAVSGIPKIRSPIRG
Ga0307475_1070137113300031754Hardwood Forest SoilAPDTDEEMTRKVLDLIETDAELKAAVSGTPKIRSAVRG
Ga0307471_10186746323300032180Hardwood Forest SoilPEARVQFAEGGLELLVRYPVEIRRAPDTDEDMTRRVLDLIAKDETLKAAVSGIPKIRSAIRG
Ga0348332_1321634033300032515Plant LitterLELLVRYPVEIRKATDIDQQMTRKVLELVETDTALKEIISGTPKIRSVVKG
Ga0316226_106698313300032562FreshwaterQFTDAGLELLVRYPVMIRQAPEVDEQMTRSVLGLIESDPAVKDAVAGNPGIRSAVKG
Ga0335079_10001888113300032783SoilVRYPVEIRKAPDIDEEMTRKVLGLIETDAALKAAVSGNPKIRSAVKG
Ga0335078_1113858013300032805SoilRIQFADAGLELLVRYPVEIRRAPDIDEEMTRKVLELIERDDSLKAAIIGTPKIRSAVKG
Ga0335071_1059184223300032897SoilLTSGVNRSRPEARLQFADAGLELLVRYPVDLRRAPDTDEEMTRKVLDLFAKDQTLKSAVSGTPKIRSAIRG
Ga0310914_1144004423300033289SoilLELLLRYPVEIRRAPDTDEEMTQRVLDLIAKDEAVKAAVSGSPKIRSAIRG
Ga0310811_1125813523300033475SoilNEGLELLVRYPVEIRRAPDVDEEMTRTVLDLVQKDAGLKAAVSGTPKIRSAIKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.