NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068109

Metagenome / Metatranscriptome Family F068109

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068109
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 46 residues
Representative Sequence MIEALQQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFVAYK
Number of Associated Samples 96
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.40 %
% of genes near scaffold ends (potentially truncated) 16.80 %
% of genes from short scaffolds (< 2000 bps) 78.40 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.800 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(28.000 % of family members)
Environment Ontology (ENVO) Unclassified
(48.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(53.600 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.44%    β-sheet: 21.92%    Coil/Unstructured: 61.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF13847Methyltransf_31 41.60
PF08241Methyltransf_11 18.40
PF13649Methyltransf_25 4.80
PF03401TctC 2.40
PF00211Guanylate_cyc 2.40
PF03992ABM 2.40
PF02635DrsE 1.60
PF13489Methyltransf_23 1.60
PF060523-HAO 1.60
PF01070FMN_dh 1.60
PF13191AAA_16 0.80
PF13941MutL 0.80
PF00190Cupin_1 0.80
PF13432TPR_16 0.80
PF00581Rhodanese 0.80
PF09130DUF1932 0.80
PF04542Sigma70_r2 0.80
PF09084NMT1 0.80
PF13746Fer4_18 0.80
PF03435Sacchrp_dh_NADP 0.80
PF00589Phage_integrase 0.80
PF12773DZR 0.80
PF02518HATPase_c 0.80
PF07883Cupin_2 0.80
PF02641DUF190 0.80
PF09948DUF2182 0.80
PF07040DUF1326 0.80
PF12244DUF3606 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 2.40
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.40
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 1.60
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 1.60
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.80
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.80
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.80
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.80
COG1993PII-like signaling proteinSignal transduction mechanisms [T] 0.80
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.80
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.80
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.80
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.80 %
UnclassifiedrootN/A3.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_106549838All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300002104|C687J26621_10017774All Organisms → cellular organisms → Bacteria → Proteobacteria3075Open in IMG/M
3300002104|C687J26621_10020228All Organisms → cellular organisms → Bacteria → Proteobacteria2813Open in IMG/M
3300002104|C687J26621_10035054Not Available1943Open in IMG/M
3300002104|C687J26621_10114293All Organisms → cellular organisms → Bacteria → Proteobacteria852Open in IMG/M
3300002121|C687J26615_10004639All Organisms → cellular organisms → Bacteria3045Open in IMG/M
3300002121|C687J26615_10005859All Organisms → cellular organisms → Bacteria2777Open in IMG/M
3300002121|C687J26615_10116680All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300002121|C687J26615_10140128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas linyingensis610Open in IMG/M
3300002122|C687J26623_10001547All Organisms → cellular organisms → Bacteria → Proteobacteria4849Open in IMG/M
3300003392|JGI26134J50242_102909All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium579Open in IMG/M
3300003999|Ga0055469_10207506All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300004009|Ga0055437_10320070All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300004463|Ga0063356_100124457All Organisms → cellular organisms → Bacteria2871Open in IMG/M
3300004463|Ga0063356_101488873All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae1001Open in IMG/M
3300005577|Ga0068857_101043716Not Available788Open in IMG/M
3300006169|Ga0082029_1297904All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300006845|Ga0075421_100403864All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1640Open in IMG/M
3300006865|Ga0073934_10004289All Organisms → cellular organisms → Bacteria → Proteobacteria24063Open in IMG/M
3300006876|Ga0079217_11117649All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300006894|Ga0079215_10882164All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300009053|Ga0105095_10643169All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009078|Ga0105106_10144877All Organisms → cellular organisms → Bacteria → Proteobacteria1745Open in IMG/M
3300009078|Ga0105106_10609073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas linyingensis782Open in IMG/M
3300009087|Ga0105107_10373271All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300009444|Ga0114945_10374035All Organisms → cellular organisms → Bacteria → Proteobacteria847Open in IMG/M
3300009444|Ga0114945_10475804Not Available750Open in IMG/M
3300009444|Ga0114945_11043197All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009609|Ga0105347_1512609Not Available521Open in IMG/M
3300009610|Ga0105340_1044861All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300009610|Ga0105340_1167138All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300009678|Ga0105252_10206170All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300009691|Ga0114944_1123533All Organisms → cellular organisms → Bacteria → Proteobacteria1001Open in IMG/M
3300010408|Ga0137020_103567All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300011410|Ga0137440_1054493All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300011425|Ga0137441_1072972All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300011427|Ga0137448_1094974All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria801Open in IMG/M
3300011429|Ga0137455_1086300All Organisms → cellular organisms → Bacteria → Proteobacteria911Open in IMG/M
3300011435|Ga0137426_1239299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas linyingensis542Open in IMG/M
3300011441|Ga0137452_1314572All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300012038|Ga0137431_1015267All Organisms → cellular organisms → Bacteria → Proteobacteria2097Open in IMG/M
3300012133|Ga0137329_1009323All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300012140|Ga0137351_1014536All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300012142|Ga0137343_1000632All Organisms → cellular organisms → Bacteria → Proteobacteria3767Open in IMG/M
3300012159|Ga0137344_1092849All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012166|Ga0137350_1086286All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300012171|Ga0137342_1010902All Organisms → cellular organisms → Bacteria → Proteobacteria1533Open in IMG/M
3300012173|Ga0137327_1129635All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300012231|Ga0137465_1157746All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300012671|Ga0137318_1023264All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012675|Ga0137337_1012404All Organisms → cellular organisms → Bacteria → Proteobacteria1162Open in IMG/M
3300014255|Ga0075320_1007499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1609Open in IMG/M
3300014271|Ga0075326_1240125All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300014325|Ga0163163_11038381All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300014864|Ga0180068_1034285All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300014872|Ga0180087_1011750All Organisms → cellular organisms → Bacteria → Proteobacteria1509Open in IMG/M
3300014872|Ga0180087_1059598All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300014873|Ga0180066_1009821All Organisms → cellular organisms → Bacteria → Proteobacteria1621Open in IMG/M
3300014876|Ga0180064_1079315All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300014878|Ga0180065_1147666All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300014880|Ga0180082_1047405All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300014880|Ga0180082_1093490All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300014882|Ga0180069_1033352All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300014883|Ga0180086_1041242All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300015254|Ga0180089_1010054All Organisms → cellular organisms → Bacteria → Proteobacteria1632Open in IMG/M
3300015255|Ga0180077_1019893All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300015256|Ga0180073_1109790All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018027|Ga0184605_10448500All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300018031|Ga0184634_10088310All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300018031|Ga0184634_10226998All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300018063|Ga0184637_10047034All Organisms → cellular organisms → Bacteria → Proteobacteria2627Open in IMG/M
3300018063|Ga0184637_10394796All Organisms → cellular organisms → Bacteria → Proteobacteria825Open in IMG/M
3300018074|Ga0184640_10143368All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300018077|Ga0184633_10154538All Organisms → cellular organisms → Bacteria → Proteobacteria1189Open in IMG/M
3300018084|Ga0184629_10189959All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300018422|Ga0190265_10147447All Organisms → cellular organisms → Bacteria → Proteobacteria2296Open in IMG/M
3300018422|Ga0190265_11779432All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300018429|Ga0190272_10385586All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300018469|Ga0190270_12100381All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018469|Ga0190270_12538085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli575Open in IMG/M
3300019228|Ga0180119_1122687All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria808Open in IMG/M
3300019238|Ga0180112_1030977All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300021063|Ga0206227_1011605All Organisms → cellular organisms → Bacteria → Proteobacteria1336Open in IMG/M
3300022563|Ga0212128_10130257All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300025002|Ga0209001_1060206All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300025149|Ga0209827_11015395All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300025160|Ga0209109_10008628All Organisms → cellular organisms → Bacteria → Proteobacteria5460Open in IMG/M
3300025160|Ga0209109_10018888All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3715Open in IMG/M
3300025160|Ga0209109_10373037All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025165|Ga0209108_10092643All Organisms → cellular organisms → Bacteria → Proteobacteria1635Open in IMG/M
3300025165|Ga0209108_10160538All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300025310|Ga0209172_10001109All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria62181Open in IMG/M
3300025311|Ga0209343_10009026All Organisms → cellular organisms → Bacteria → Proteobacteria11494Open in IMG/M
3300025311|Ga0209343_10014830All Organisms → cellular organisms → Bacteria8512Open in IMG/M
3300025318|Ga0209519_10734375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas linyingensis528Open in IMG/M
3300025324|Ga0209640_10001158All Organisms → cellular organisms → Bacteria → Proteobacteria21966Open in IMG/M
3300025324|Ga0209640_10008998All Organisms → cellular organisms → Bacteria → Proteobacteria8700Open in IMG/M
3300025324|Ga0209640_10131035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2153Open in IMG/M
3300027533|Ga0208185_1020228All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300027637|Ga0209818_1239178All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300027665|Ga0209983_1099326All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300027818|Ga0209706_10052571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2053Open in IMG/M
3300027909|Ga0209382_10547356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1268Open in IMG/M
3300030006|Ga0299907_10555241All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300031229|Ga0299913_10860984All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300031834|Ga0315290_10089395All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2578Open in IMG/M
3300031949|Ga0214473_11824973All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58600Open in IMG/M
3300031965|Ga0326597_10014835All Organisms → cellular organisms → Bacteria → Proteobacteria10201Open in IMG/M
3300031965|Ga0326597_10066132All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4484Open in IMG/M
3300031965|Ga0326597_10606131All Organisms → cellular organisms → Bacteria → Proteobacteria1170Open in IMG/M
3300031965|Ga0326597_10606977All Organisms → cellular organisms → Bacteria → Proteobacteria1169Open in IMG/M
3300031965|Ga0326597_10868712All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300031965|Ga0326597_11603579All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300032002|Ga0307416_101848101All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300033407|Ga0214472_10352180All Organisms → cellular organisms → Bacteria → Proteobacteria1391Open in IMG/M
3300033417|Ga0214471_10021236All Organisms → cellular organisms → Bacteria → Proteobacteria5171Open in IMG/M
3300033417|Ga0214471_10941013All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300033513|Ga0316628_100268678All Organisms → cellular organisms → Bacteria → Proteobacteria2101Open in IMG/M
3300033551|Ga0247830_10008955All Organisms → cellular organisms → Bacteria → Proteobacteria5293Open in IMG/M
3300033811|Ga0364924_011675All Organisms → cellular organisms → Bacteria → Proteobacteria1639Open in IMG/M
3300033813|Ga0364928_0040554All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300033814|Ga0364930_0063981All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halomonas1251Open in IMG/M
3300034114|Ga0364938_054391All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300034165|Ga0364942_0002893All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4993Open in IMG/M
3300034354|Ga0364943_0224830All Organisms → cellular organisms → Bacteria695Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil28.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.40%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.40%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil6.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.60%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater4.80%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs4.80%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment4.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil4.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.20%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.40%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.60%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.60%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.60%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.60%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.80%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.80%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002104Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2EnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300003392Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PMHost-AssociatedOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300010408Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011425Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012140Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2EnvironmentalOpen in IMG/M
3300012142Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT499_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012671Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2EnvironmentalOpen in IMG/M
3300012675Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2EnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025002Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes)EnvironmentalOpen in IMG/M
3300025149Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes)EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025311Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10654983833300000956SoilMIEALHQAGFRNARACHFFDSFSGTAKERVARKYEVLGANFVAHK*
C687J26621_1001777443300002104GroundwaterMIEALQQIGFRDVRACHYFNSFSGTTKEGVARKYGVQGANFVAYKAA*
C687J26621_1002022833300002104GroundwaterMIEALQKSGFRNARACHFFDSFLGTTKEAVARKYGVRGANFVAYK*
C687J26621_1003505413300002104GroundwaterQVAEMIEALQKSGFRNARACHFFDSFLGTTKEGVARKYGVRGANFVAHK*
C687J26621_1011429323300002104GroundwaterMIEALQQIGFQDVRACHFFNSFSGTTKEGVARKYGVQGANFVAYKAA*
C687J26615_1000463923300002121SoilMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKAA*
C687J26615_1000585923300002121SoilMIEALQQTGFQRVRVCHFFNSFSGTTKEGVARKYAVQGANFIAYKAA*
C687J26615_1011668023300002121SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEGVARKYGVQGANFIAHKAA*
C687J26615_1014012823300002121SoilGALQVAEMIEALQQAGFRSARANHFFDSFSGTTKERVARKYEVRGANFXAHK*
C687J26623_1000154743300002122SoilMIEALQQTGFLRVRVXXFFNSFSGTTKEGVARKYGVQGANFIAYKAA*
JGI26134J50242_10290923300003392Arabidopsis Thaliana RhizosphereMIEALQQAGFHDVRACHFFDSFAGTNKERVAKKYGVRGTNFTAVK*
Ga0055469_1020750623300003999Natural And Restored WetlandsMIEALHQAGFRNARARSFFDSFSGTAKETIARKYGVRGANFSAYKVA*
Ga0055437_1032007013300004009Natural And Restored WetlandsMMEVMERFGFRNAKACHFFDSFAGTTKERIARKFGVTGANFLAVKPR*
Ga0063356_10012445743300004463Arabidopsis Thaliana RhizosphereMTEALSRAGFRNARATHFFESFLGTSKERVANKYGVRGVNFIAWK*
Ga0063356_10148887333300004463Arabidopsis Thaliana RhizosphereMIEALRQAGFRDVRACQVFDSFAGTSKERVARKYEVRGGNFMAW
Ga0068857_10104371633300005577Corn RhizosphereQSAEMIELLGQIGFKRGAAVRFFDSFAGTTKERVAQKYQVRGANFIAYK*
Ga0082029_129790423300006169Termite NestMIQALESVGFRNVRACEFFDSFQGTNKENIARKFDVRGANFIAYK*
Ga0075421_10040386433300006845Populus RhizosphereMIEALQKAGFRNARACRFFDSFSGTTKERVARKYGVRGANFVAYR*
Ga0073934_10004289133300006865Hot Spring SedimentMIEALRQAGFRDVRACQFFDSFAGTNKERVARKYDVRGTNFIARK*
Ga0079217_1111764923300006876Agricultural SoilMLDVIHRSGFRDARASHSFDSFKGTSKERVAAKYGVRGVNFTAYK*
Ga0079215_1088216423300006894Agricultural SoilMIEALKQAGFRDVRACQVFDSFAGTSKERVARKYEVRGGNFMARK*
Ga0105095_1064316923300009053Freshwater SedimentMIEALEAAGFRSARACHFRDTIAGTSKERVARKYQVQGANFMAFK*
Ga0105106_1014487733300009078Freshwater SedimentMIEALEAAGFRSARACHFLDSFAGTSKERVARKYQVQGANFMAFK*
Ga0105106_1060907323300009078Freshwater SedimentMIEALQQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0105107_1037327123300009087Freshwater SedimentMTEALSRAGFRNARATYFFESFLGTSKERVANKYGVRGVNFIAWK*
Ga0114945_1037403523300009444Thermal SpringsMIEALQQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFVAYK*
Ga0114945_1047580423300009444Thermal SpringsMIDIIHRAGFRDARVCRFFDSFAGTTKEAVARKFGVRGANFTALKPAGS*
Ga0114945_1104319723300009444Thermal SpringsMIEVIHQAGFRNARACRLFDCFSGTAKERVARKYQVRGANFIAY
Ga0105347_151260923300009609SoilIAGALQVAELIEALQQTGFRNVRACNFFNSFSGTTKEGVARKYGVRGANFIAYKAA*
Ga0105340_104486113300009610SoilMIEVLSQAGFRNARAHHFFDSFAGTTKERVARKYGVRGANFTAYKAA*
Ga0105340_116713823300009610SoilMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKTA*
Ga0105252_1020617023300009678SoilMIEALQQAGFRDARACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0114944_112353323300009691Thermal SpringsMIDIIHRAGFGDARVCRFFDSFAGTTKEAVARKFGVRGANFTALKPAGS*
Ga0137020_10356723300010408SoilMIEALHQAGFRNARACHFFDSFSGTTKEGVARKYGVQGANFIAHK*
Ga0137440_105449323300011410SoilMIEALQQAGFRNAHACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0137441_107297213300011425SoilAELIEALQETGFRNVRACNFFNSFSGTTKEGVARKYGVQGANFIAYKAA*
Ga0137448_109497423300011427SoilMIEALQQAGFRNAHARQFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0137455_108630023300011429SoilMIQVIQQAGFRNARACHFFDSFSGTTKERVARKYGVRGANFIAYKAP*
Ga0137426_123929913300011435SoilIAGALQVAEMIEALHQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0137452_131457223300011441SoilMIEALRQAGFRDARACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0137431_101526763300012038SoilMIEALQQAGFRNARASHFFDSFSGTTKERLARKYEVRGANFIAHK*
Ga0137329_100932323300012133SoilMIEALQQTGFQSVRICNFFDSFSGTTKEKVARKYGVQGANFMAYKAA*
Ga0137351_101453623300012140SoilMIEALQQTGFRSVRVCNFFNSFSGTTKEKVARKYGVQGANFMAYKAA*
Ga0137343_100063243300012142SoilMIEALQQTGFQRVRVCNFFTSFSGTTKEGVARKYGVQGANFIAYKAA*
Ga0137344_109284923300012159SoilMIEALQQTGFRIVRVCHFFNSFSGTTKEGVARKYGVQGANFIAYRAA*
Ga0137350_108628623300012166SoilFQGVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKAA*
Ga0137342_101090213300012171SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEGVARKYG
Ga0137327_112963523300012173SoilMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFMAYKAA*
Ga0137465_115774623300012231SoilMIEALQQTGFRRVRVCNFFNSFSGTTKEGVARKYGVQGANFIAYRAA*
Ga0137318_102326423300012671SoilMIEALQQSGFRSVRVCNFFDSFSGTTKEKVARKYGVQGANFMAYKAA*
Ga0137337_101240433300012675SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEGVARKYGVQGANFIAFKAA*
Ga0075320_100749923300014255Natural And Restored WetlandsMIEALHQAGFRNARARNFFDSFSGTTKEGIAHKYGVRGANFIAYKVL*
Ga0075326_124012523300014271Natural And Restored WetlandsMIEALHQAGFRNARARSFFDSFSGTAKETIARKYGVRGANFSAYKLA*
Ga0163163_1103838133300014325Switchgrass RhizosphereMIELLGQIGFKRGAAVRFFDSFAGTTKERVAQKYQVRGANFIAYK*
Ga0180068_103428523300014864SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEKVARKYGVQGANFMAYKAA*
Ga0180087_101175033300014872SoilMIEALQQSGFRSVRVCNFFDSFSGTTKEKVARKYGVQGANFIAYKTA*
Ga0180087_105959823300014872SoilMIEALQQARFRNARACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0180066_100982133300014873SoilMIEALSQAGFRNARARHFFDSFAGTTKEGVARKYGVRGANFTAYKGA*
Ga0180064_107931523300014876SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEKVARKYGVQGANFIAYKTA*
Ga0180065_114766613300014878SoilMIEALHQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFMAMK*
Ga0180082_104740513300014880SoilMIEALQQAGFRNVRVCNFFDSFSETTKERVARKYG
Ga0180082_109349023300014880SoilGALQVAEMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKTA*
Ga0180069_103335233300014882SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEGVARKYGVQGANFMAYKAA*
Ga0180086_104124223300014883SoilMIEALHQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFVAHK*
Ga0180089_101005413300015254SoilMIEALQQSGFRSVRVCNFFNSFSGTTKEGVARKYGVQGANFIAFKVA*
Ga0180077_101989333300015255SoilEALQQTGFQRVRVCNFFTSFSGTTKEGVARKYGVQGANFIAYKAA*
Ga0180073_110979023300015256SoilMIEALQQSGFRSVRVCNFFDSFSGTTKEKVARKYGVQG
Ga0184605_1044850023300018027Groundwater SedimentMIQALEEVGFRNARVCDYFDSFSGTNKENVARKFGVRGANFIAYR
Ga0184634_1008831023300018031Groundwater SedimentMIEVLSQAGFRNARARHFFDSFAGTTKEGVARKYGVRGANFTAYKAA
Ga0184634_1022699823300018031Groundwater SedimentMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYRAA
Ga0184637_1004703433300018063Groundwater SedimentMIEALQQTGFQRVRVCNFFNSFSGTTKEGVARKYGVQGANFIAYRAA
Ga0184637_1039479623300018063Groundwater SedimentMIQVIQQAGFRNARACRFFDSFSGTTKERVARKYGVRGANFTAYKAA
Ga0184640_1014336843300018074Groundwater SedimentMIEALQQTGFQRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKAA
Ga0184633_1015453823300018077Groundwater SedimentMIQVIQQAGFRNARACHFFDSFSGTTKERVARKYGVRGANFIAYKAP
Ga0184629_1018995923300018084Groundwater SedimentMIEALQQTGFRSVRVCNFFNSFSGTTKEKVARKYGVQGANFMAYKAA
Ga0190265_1014744733300018422SoilMTELLEKTGFRNVAPRRFFDSFAGTTKERVAGKYQVRGANFIAYK
Ga0190265_1177943213300018422SoilMIEALHRAGFRNARARRFFDSFSATTKEEIARKYDVRGANFIAYK
Ga0190272_1038558623300018429SoilMIEALHQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFVAHK
Ga0190270_1210038113300018469SoilMIEALRQTGFLNVRVCNHFNSFSGTTKERVARKYGVQGANFIAYRAA
Ga0190270_1253808523300018469SoilMIEALHQAGFRNVRACDFFDSFSGTTKERVARKYEVRGANFVAHK
Ga0180119_112268723300019228Groundwater SedimentMIEALQQAGFRNARACHYFDSFSGTTKERVARKYEVRGANFMAMK
Ga0180112_103097733300019238Groundwater SedimentMIEALQQTGFQRVRVCNFFTSFSGTTKEGVARKYGVQGANFIAYKAA
Ga0206227_101160533300021063Deep Subsurface SedimentMIEALQQTGFQRVRVWHFFNSFSGTTKEGVARKYGVQGANFVAYKAA
Ga0212128_1013025723300022563Thermal SpringsMIDIIHRAGFRDARVCRFFDSFAGTTKEAVARKFGVRGANFTALKPAGS
Ga0209001_106020623300025002SoilMIEALQQTGFQRVRVCHFFNSFSGTTKEGVARKYAVQGANFIAYKAA
Ga0209827_1101539513300025149Thermal SpringsMIDIIHRAGFGDARVCRFFDSFAGTTKEAVARKFGVRGANFTALKPAGS
Ga0209109_1000862843300025160SoilMIEALQQIGFQDVRACHFFNSFAGTTKEGVARKYGVQGANFVAYKAA
Ga0209109_1001888823300025160SoilMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKAA
Ga0209109_1037303723300025160SoilMIEALQQTGFQSVRVCNFFNSFSGTTKEGVARKYGVQGANFIAHKAA
Ga0209108_1009264323300025165SoilMIEALQQIGFQDVRACHFFNSFSGTTKEGVARKYGVQGANFVAYKAA
Ga0209108_1016053813300025165SoilNVRVCNFFNSFSGTTKEGVARKYGVQGANFVAYKAG
Ga0209172_10001109223300025310Hot Spring SedimentMIEALRQAGFRDVRACQFFDSFAGTNKERVARKYDVRGTNFIARK
Ga0209343_1000902673300025311GroundwaterMIEALQKSGFRNARACHFFDSFLGTTKEAVARKYGVRGANFVAYK
Ga0209343_1001483093300025311GroundwaterMIEALQQIGFRDVRACHYFNSFSGTTKEGVARKYGVQGANFVAYKAA
Ga0209519_1073437513300025318SoilLQQAGFRSARANHFFDSFSGTTKERVARKYEVRGANFIAHK
Ga0209640_10001158223300025324SoilMIEALQQAGFRSARANHFFDSFSGTTKERVARKYEVRGANFIAHK
Ga0209640_1000899823300025324SoilMIEALQQTGFRNVRVCNFFNSFSGTTKEGVARKYGVQGANFVAYKAG
Ga0209640_1013103513300025324SoilMIEALQKSGFRNARACHFFDSFLGTTKEGVARKYGVRGANFVAHK
Ga0208185_102022823300027533SoilMIEVLSQAGFRNARAHHFFDSFAGTTKERVARKYGVRGANFTAYKAA
Ga0209818_123917823300027637Agricultural SoilMLDVIHRSGFRDARASHSFDSFKGTSKERVAAKYGVRGVNFTAYK
Ga0209983_109932623300027665Arabidopsis Thaliana RhizosphereMIEALQQAGFHDVRACHFFDSFAGTNKERVAKKYGVRGTNFTAVK
Ga0209706_1005257143300027818Freshwater SedimentMIEALEAAGFRSARACHFLDSFAGTSKERVARKYQVQGANFMAFK
Ga0209382_1054735633300027909Populus RhizosphereMIEALQKAGFRNARACRFFDSFSGTTKERVARKYGVRGANFVAYR
Ga0299907_1055524123300030006SoilMIEALHQAGFRNARARSFFDSFSGTAKETIAHKYGVRGANFSAYKVA
Ga0299913_1086098423300031229SoilMIEALHQAGFRNARARSFFDSFSGTAKETIARKYGVRGANFSAYKVAQEV
Ga0315290_1008939533300031834SedimentMAEAGFRNAASRDIFDSFLGSSKEATARKFGVLGANFIAYK
Ga0214473_1182497323300031949SoilHRAGFRNARACQFFDSFLGTTNEALARKYGVQGANFVAYKAS
Ga0326597_1001483523300031965SoilMIEALQQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFMAMK
Ga0326597_1006613253300031965SoilMIEALSQAGFRNARARHFFDSFAGTTKEGVARKYGVRGANFTAYKGA
Ga0326597_1060613123300031965SoilMIEALQQAGFRNARACHFFDSFAGTTKERVARKYEVRGANFVAYK
Ga0326597_1060697723300031965SoilMIEALQQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFVAYK
Ga0326597_1086871223300031965SoilMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYAVQGANFIAYKAA
Ga0326597_1160357923300031965SoilMIEALQRAGFRNARACHFFDSFAGTTKERVARKYDVRGANFVAYK
Ga0307416_10184810123300032002RhizosphereMIQALEAAGFRNARACEFFDSFAGTNKENIARKFDVRGANFTAYR
Ga0214472_1035218023300033407SoilMIEVMHRAGFRNARACQFFDSFLGTTKEALARKYGVQGANFVAYKAS
Ga0214471_1002123613300033417SoilIAGALQVAEMIEALQQAGFRNARACHFFDSFSGTTKERVARKYEVRGANFVAYK
Ga0214471_1094101323300033417SoilMIEIIHRAGFRDARVCQYFDSFLGTTKEALARKYGVQG
Ga0316628_10026867823300033513SoilMIEAMSEAGFRDSRACHFFDSFQGTSKENVARKFGVQGANFIAYKT
Ga0247830_1000895513300033551SoilMTEALSRAGFRNARATHFFESFLGTSKERVANKYGVRGVNFIAWK
Ga0364924_011675_1223_13663300033811SedimentMIEALKQAGFHDVRATHFFDSFRGTNKERVAGKYGVRGTNFIGWKQG
Ga0364928_0040554_363_5063300033813SedimentMIEALQQSGFRSVRVCNFFDSFSGTTKEKVARKYGVQGANFMAYKAA
Ga0364930_0063981_3_1433300033814SedimentIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFVAYKAA
Ga0364938_054391_581_7033300034114SedimentMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANF
Ga0364942_0002893_318_4613300034165SedimentMIEALQQTGFQGVRVWHFFNSFSGTTKEGVARKYGVQGANFVAYKAA
Ga0364943_0224830_8_1513300034354SedimentMIEALQQTGFLRVRVWHFFNSFSGTTKEGVARKYGVQGANFIAYKTA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.