NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068270

Metagenome / Metatranscriptome Family F068270

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068270
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 48 residues
Representative Sequence MHTRVLKPRNGPTLLVRPLRNGDVATVLAVFERLGPESRRARFNGPK
Number of Associated Samples 106
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.68 %
% of genes near scaffold ends (potentially truncated) 98.40 %
% of genes from short scaffolds (< 2000 bps) 95.20 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.200 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.800 % of family members)
Environment Ontology (ENVO) Unclassified
(32.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.600 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.33%    β-sheet: 8.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF01638HxlR 41.60
PF03167UDG 18.40
PF13302Acetyltransf_3 3.20
PF07883Cupin_2 2.40
PF08031BBE 1.60
PF05958tRNA_U5-meth_tr 1.60
PF00581Rhodanese 0.80
PF00583Acetyltransf_1 0.80
PF01475FUR 0.80
PF12680SnoaL_2 0.80
PF00353HemolysinCabind 0.80
PF13180PDZ_2 0.80
PF07992Pyr_redox_2 0.80
PF01551Peptidase_M23 0.80
PF02811PHP 0.80
PF04679DNA_ligase_A_C 0.80
PF02574S-methyl_trans 0.80
PF14026DUF4242 0.80
PF07690MFS_1 0.80
PF04073tRNA_edit 0.80
PF03699UPF0182 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 41.60
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 18.40
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 18.40
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 18.40
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 1.60
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 1.60
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.80
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.80
COG1615Uncharacterized membrane protein, UPF0182 familyFunction unknown [S] 0.80
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.80
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.20 %
UnclassifiedrootN/A20.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908044|A5_c1_ConsensusfromContig1896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1459Open in IMG/M
3300001361|A30PFW6_1225874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1015Open in IMG/M
3300002568|C688J35102_120031431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300004114|Ga0062593_100919385All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300004479|Ga0062595_100131871All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300004479|Ga0062595_100318444All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300005435|Ga0070714_102120283All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005437|Ga0070710_11328406Not Available535Open in IMG/M
3300005437|Ga0070710_11543566All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005518|Ga0070699_102062551All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina521Open in IMG/M
3300005532|Ga0070739_10462041All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005538|Ga0070731_10237413All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300005547|Ga0070693_101052159All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005547|Ga0070693_101456212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300005587|Ga0066654_10275800All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300005764|Ga0066903_102148147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300005841|Ga0068863_101180598Not Available771Open in IMG/M
3300005893|Ga0075278_1079373Not Available522Open in IMG/M
3300006046|Ga0066652_101517414All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300006046|Ga0066652_101689191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300006059|Ga0075017_101581331All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006173|Ga0070716_101307749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria586Open in IMG/M
3300006175|Ga0070712_101089271All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300006358|Ga0068871_100745485Not Available900Open in IMG/M
3300006796|Ga0066665_10182032All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300006804|Ga0079221_11419587Not Available553Open in IMG/M
3300006806|Ga0079220_10773446All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300006854|Ga0075425_101024080All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300006914|Ga0075436_100876149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium671Open in IMG/M
3300006914|Ga0075436_101326580All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009088|Ga0099830_10971815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300009137|Ga0066709_103813259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300009143|Ga0099792_10958978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae569Open in IMG/M
3300009148|Ga0105243_12639662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300009174|Ga0105241_10777653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia880Open in IMG/M
3300009792|Ga0126374_11567099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300010039|Ga0126309_10495771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300010362|Ga0126377_12768297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300010366|Ga0126379_11947969Not Available690Open in IMG/M
3300010371|Ga0134125_10285864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1832Open in IMG/M
3300010373|Ga0134128_10874431Not Available995Open in IMG/M
3300010399|Ga0134127_10505682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1221Open in IMG/M
3300010400|Ga0134122_13394544Not Available501Open in IMG/M
3300011119|Ga0105246_11751425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300012189|Ga0137388_11217724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300012189|Ga0137388_11507686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300012198|Ga0137364_10766335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia729Open in IMG/M
3300012201|Ga0137365_10188578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1544Open in IMG/M
3300012201|Ga0137365_10947473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300012202|Ga0137363_10274903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1376Open in IMG/M
3300012202|Ga0137363_11502458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300012206|Ga0137380_10841213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae790Open in IMG/M
3300012209|Ga0137379_11605511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300012354|Ga0137366_10218298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1420Open in IMG/M
3300012356|Ga0137371_11445398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae502Open in IMG/M
3300012911|Ga0157301_10236499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae635Open in IMG/M
3300012915|Ga0157302_10442648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300012918|Ga0137396_11081278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300012957|Ga0164303_10783838Not Available653Open in IMG/M
3300012957|Ga0164303_11436423Not Available518Open in IMG/M
3300012958|Ga0164299_10027418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2429Open in IMG/M
3300012958|Ga0164299_10362824All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300012960|Ga0164301_10238205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1187Open in IMG/M
3300012960|Ga0164301_10603073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300012960|Ga0164301_11296790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300012985|Ga0164308_12031850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae536Open in IMG/M
3300012988|Ga0164306_10513681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia924Open in IMG/M
3300013102|Ga0157371_11469649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300013105|Ga0157369_10643268Not Available1094Open in IMG/M
3300013297|Ga0157378_12346197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300013308|Ga0157375_10396827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1546Open in IMG/M
3300013308|Ga0157375_11471504Not Available803Open in IMG/M
3300014058|Ga0120149_1244224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae504Open in IMG/M
3300014968|Ga0157379_12123286Not Available557Open in IMG/M
3300015242|Ga0137412_10100617All Organisms → cellular organisms → Bacteria2349Open in IMG/M
3300015372|Ga0132256_100464377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1374Open in IMG/M
3300015373|Ga0132257_101419195Not Available884Open in IMG/M
3300015374|Ga0132255_101960919Not Available891Open in IMG/M
3300017937|Ga0187809_10406609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300017947|Ga0187785_10566669Not Available577Open in IMG/M
3300017947|Ga0187785_10667526Not Available542Open in IMG/M
3300018073|Ga0184624_10370748All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300020070|Ga0206356_11666191Not Available560Open in IMG/M
3300021560|Ga0126371_11010935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium973Open in IMG/M
3300021560|Ga0126371_12240457Not Available659Open in IMG/M
3300025898|Ga0207692_10955103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300025912|Ga0207707_10225697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1630Open in IMG/M
3300025914|Ga0207671_10072984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2562Open in IMG/M
3300025919|Ga0207657_10691364Not Available792Open in IMG/M
3300025926|Ga0207659_10317698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1284Open in IMG/M
3300025927|Ga0207687_10101001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2123Open in IMG/M
3300025928|Ga0207700_10245326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1528Open in IMG/M
3300025932|Ga0207690_10948978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300025934|Ga0207686_10253188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1287Open in IMG/M
3300025937|Ga0207669_11234604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300025939|Ga0207665_10103896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1988Open in IMG/M
3300025939|Ga0207665_11189312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300025944|Ga0207661_11102258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300025944|Ga0207661_11110528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300026078|Ga0207702_10635707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1049Open in IMG/M
3300026325|Ga0209152_10106218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1062Open in IMG/M
3300027725|Ga0209178_1093119Not Available1000Open in IMG/M
3300027869|Ga0209579_10309338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300027869|Ga0209579_10343980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia807Open in IMG/M
3300027873|Ga0209814_10383621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Bailinhaonella → Bailinhaonella thermotolerans617Open in IMG/M
3300027874|Ga0209465_10574692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300028799|Ga0307284_10494531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300028824|Ga0307310_10105844Not Available1256Open in IMG/M
3300028828|Ga0307312_10486355All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300028872|Ga0307314_10290414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031231|Ga0170824_116373408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300031572|Ga0318515_10154338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300031847|Ga0310907_10874970Not Available507Open in IMG/M
3300031959|Ga0318530_10370645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300031996|Ga0308176_12566745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300032001|Ga0306922_11931796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300032044|Ga0318558_10087459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1443Open in IMG/M
3300032074|Ga0308173_10394435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae1216Open in IMG/M
3300032089|Ga0318525_10313461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300032782|Ga0335082_10178453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2034Open in IMG/M
3300032783|Ga0335079_11333493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300032829|Ga0335070_11066295Not Available744Open in IMG/M
3300033004|Ga0335084_11368874Not Available703Open in IMG/M
3300033412|Ga0310810_10620963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1031Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.20%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.20%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.20%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.20%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.40%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.40%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.80%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.80%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.80%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.80%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A5_c1_016660402124908044SoilMHTRVIKPRHGPTLLVRPLERGDVATVSAVFERLGDESRR
A30PFW6_122587433300001361PermafrostMHTRVLKPRNGPTLLVRPLRNGDVATVLAVFERLGPESRRARFNGPK
C688J35102_12003143113300002568SoilMQTRYLTPKDGPHLIVRPLRNGDGTTVLQVFERLGADSRRARFNGPKPCLSAAE
Ga0062593_10091938513300004114SoilMHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDESRRARFNGPKPCLRKAELQR
Ga0062595_10013187133300004479SoilMHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGGLGERSRRTRFNGPK
Ga0062595_10031844423300004479SoilMHTRILKPRHAPSLLVRPLRHRDMQTVLAVFERLSDESRRNRFNGPKPSLT
Ga0070714_10212028323300005435Agricultural SoilMHTRILTPKHGPALVVRPLRDGDTGTVAAVFARLGPESRR
Ga0070710_1132840623300005437Corn, Switchgrass And Miscanthus RhizosphereVHTRVLKLKHGPTIHVRTLRNGDVDTVISMFNRLGEQARRKRFN
Ga0070710_1154356613300005437Corn, Switchgrass And Miscanthus RhizosphereMHTRVLHLKHGPALLVRPLRRGDVRTVMAVFERLGEASRRARFNGPKPCLRMSEL
Ga0070699_10206255113300005518Corn, Switchgrass And Miscanthus RhizosphereMHTRVLKPKHGPTLLVRPLRHGDVGTIVAVFERLGERSRRARFNGPK
Ga0070739_1046204113300005532Surface SoilMHTRLVTLKHGPPLLVRPLRHGDRQTVLAVFARLGDASRRSRFNGPKPCLDEGELERLARVDDGHH
Ga0070731_1023741313300005538Surface SoilMHTRSLHLRDGRSLVVRPLRDGDLATVAAVFARVGPESRRARFNGP
Ga0070693_10105215923300005547Corn, Switchgrass And Miscanthus RhizosphereMHTRILTPKHGPSLVVRPLRDGDTATVVAVFARLSAESRRLRFNGPKPCL
Ga0070693_10145621213300005547Corn, Switchgrass And Miscanthus RhizosphereMHTRILKPKHGPVLLVRPLRRGDVRTVMAVFERLSESSRRARFNGPKPCLKTSELRQLAAID
Ga0066654_1027580043300005587SoilVHTRIVKPKHGPRLVVRPLRDGDALTVLALFERLSERSRR
Ga0066903_10214814713300005764Tropical Forest SoilMHARIVKAKRGPEIIVRPLRHGDVDTVSAVFSRLGEESRRTRFLGPKLGLGETELRW
Ga0068863_10118059833300005841Switchgrass RhizosphereMHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNASRLARFN
Ga0075278_107937323300005893Rice Paddy SoilVNTRVLESKHGLSVLVRPLRNGDVDTVLAVFHRLGQESRRTRFNG
Ga0066652_10151741423300006046SoilMHTRVVKPKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGLK
Ga0066652_10168919113300006046SoilMHTRVIKPRHGPTLIVRPLRHGDVRTVLAVFERLGDQSRRARFNGPKPCLSRDELRRLATIDS
Ga0075017_10158133113300006059WatershedsMHTRILKAKHGPTLLVKPLRNGDVRPIMAVFERLGDQSRRARFN
Ga0070716_10130774913300006173Corn, Switchgrass And Miscanthus RhizosphereMLSRLIKPPHGPSLIVRPLRDGDADTVRSVFGRLGDESRRMRFNGPKPCLSDV
Ga0070712_10108927123300006175Corn, Switchgrass And Miscanthus RhizosphereMHTRVLKPRNGPTLIVRPLRHGDVGTVLAVFDRLGPES
Ga0068871_10074548513300006358Miscanthus RhizosphereMHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGN
Ga0066665_1018203233300006796SoilMHTRVIKPKHGPTLIVRPLRHGDVRTVLAVFERLGDQSRRARFNGPKPCLSRDELRQLAT
Ga0079221_1141958733300006804Agricultural SoilVHTRVLTATRGPVLVVRPLRHGDVRTVAAVFERLSDQSRRARFNGPKPCLSRTDLRQLALVDAT
Ga0079220_1077344613300006806Agricultural SoilMHTRILTPKHGPALVVRPLRDGDTGTVAAVFARLGPESRRLRFNGPKPCLPDE
Ga0075425_10102408013300006854Populus RhizosphereMHTRVVKPKRGPEILVRPFRRGDTAPVEAVFERLGEASRRARFNGAK
Ga0075436_10087614913300006914Populus RhizosphereMHTRALNPKHGPALLVRPLRRGDVRTVMAVFHRLSDESRRARFNGS
Ga0075436_10132658023300006914Populus RhizosphereMHTRVVKAKHGPELVVRPLRHGDTATVQAVFERLGDASRRARFN
Ga0099830_1097181513300009088Vadose Zone SoilMHTRVIKPRHGPELLVRPLRRGDVATVLAVFERLGDDSRRARFHGPKP
Ga0066709_10381325913300009137Grasslands SoilMHTRVVRPKHGPELVVRPLRHGDSATVQAVFERLGDASRR
Ga0099792_1095897823300009143Vadose Zone SoilMVSKLTMHTRVLKPRNGQTLIVRPLRNGDVGTVVAAFDRLGPESR
Ga0105243_1263966213300009148Miscanthus RhizosphereMRSRILEPGHSLSLQVRPLRHGDVRTVMAVFGRLGDESRRARFNRPKPCLTAGELRQLAT
Ga0105241_1077765333300009174Corn RhizosphereMHTRILKPKHGPTRLVRPLRRGDVRTVMAVFERLS
Ga0126374_1156709923300009792Tropical Forest SoilMHTRVVRPKHGPELIVRPLRRGDTATVQAVFDRLGE
Ga0126309_1049577113300010039Serpentine SoilMHTRIVKPERVSALLVRPLRHGDVRTVMSVFERLGDRSRRARFNGAKPCLSRSELRQLAS
Ga0126377_1276829723300010362Tropical Forest SoilMYTRLVQPKHGPPLVVRPLRRGDVRTVLAVFERLGPDSRRLRFNG
Ga0126379_1194796913300010366Tropical Forest SoilMHTRIVKPKRGPELLVRPLRHGDTATVAAVFARLGEASRLARFN
Ga0134125_1028586443300010371Terrestrial SoilMHTRVVKPGYGPELVVRPLKPGDTASVHALFERLGEASRR
Ga0134128_1087443113300010373Terrestrial SoilMHTRILTPKHGPSLVVRPLRDGDTATVVAVFARLSAESRRLRFNGPKPCLPEAELRHLAR
Ga0134127_1050568233300010399Terrestrial SoilMHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGL
Ga0134122_1339454423300010400Terrestrial SoilMHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDESRRARF
Ga0105246_1175142513300011119Miscanthus RhizosphereMHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGLKHRLGEQ
Ga0137388_1121772423300012189Vadose Zone SoilMHTRVIKPRHGPTLLVRPLRHGDVQTVLAVFGRLGEQSRRTRFNGPKPCLSALELEQLAA
Ga0137388_1150768623300012189Vadose Zone SoilMHTRVIKPRHGPELLVRPLRRGDVATVLAVFERLGDDSRRARFHGPKPCLSDV
Ga0137364_1076633523300012198Vadose Zone SoilMHTRVLKPKHGPTLLVRPLRHGDVRTVMAVFERLGH
Ga0137365_1018857833300012201Vadose Zone SoilMHTRVIKPKHGPTLLVRPLRHGDVRTVLAVFERLGDRSRRTRFNGPKPCLSAAELRQLARIDS
Ga0137365_1094747313300012201Vadose Zone SoilMHTRLVKPRQGPELLVRPLTSGDVETVTAVFARLG
Ga0137363_1027490333300012202Vadose Zone SoilMHTRVLKPRNGPTLIVRPLRHGDVGTVLAVFDRLGPESRRARFNG
Ga0137363_1150245823300012202Vadose Zone SoilMHTRAIKLKHGPTILVRPLRGGDVATVRAVFEQLGDESRRARFNG
Ga0137380_1084121313300012206Vadose Zone SoilMHTRVIKLKHGPTILVRPLRAGDVATVRAVFEQLGDESRRTRFNGPKPCLSDAELAQLAA
Ga0137379_1160551113300012209Vadose Zone SoilMHTRVLKPKHGPTLLVRPLRHGDVRTVMAVFERLGHESRRARFNGPKPCLSRDELRQLAS
Ga0137366_1021829813300012354Vadose Zone SoilMHTRVIKPKHGPTLLVRPLRHGDVRTVLAIFERLGDRSRRTRFNGPKPCLSGEELRQLATID
Ga0137371_1144539823300012356Vadose Zone SoilMHTRLVKPRQGPELLVRPLTSGDVETVTAVFARLGERSRRARFMGPK
Ga0157301_1023649913300012911SoilVNLAHGRQLLIRPLRNGDVETVLDVFERLGERSRRARFNG
Ga0157302_1044264823300012915SoilVHTRIVKPKRGPSLFVRPLRRGDTATVSAMFERLGEQSRRTRFLGPKPRLSATDLE
Ga0137396_1108127823300012918Vadose Zone SoilMHTRVLKPRNGPMLIVRPLRHGDVGTVLAVFDRLGPESRRARFNGPKPCLSS
Ga0164303_1078383813300012957SoilMHTSIIRPKHGPELIVRPLKHGDTVTIQTVFERLGEASRR
Ga0164303_1143642313300012957SoilMHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNA
Ga0164299_1002741833300012958SoilMHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNASRLARFNGLKRELGE*
Ga0164299_1036282413300012958SoilMHTRVLQCHAGTLLVRPLRRGDVRTVLAVFERLGEESRRRRFNGAKPCL
Ga0164301_1023820533300012960SoilMHTRVLKPRNGPTLIVRPLRHGDVATVYADFGRLRERSRRPRFNGPKPCLSRA
Ga0164301_1060307323300012960SoilMHTRVLKPKHGPTLLVRPLRHGDVRTVVAVFERLGPQSRRARFNGPKPCLTAAELRQ
Ga0164301_1129679023300012960SoilMHTRVLHLKHGPALLVRPLRRCDVRTVMAVFERLGEASRRARFNGPKPC
Ga0164308_1203185013300012985SoilMHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGRLGERSRRTRFNG
Ga0164306_1051368113300012988SoilMHTRVLKPRNGPTLIVRPLRHGDVATVAAVFGRLGARSRRTRFNGPKPCLSPA
Ga0157371_1146964923300013102Corn RhizosphereMHTRILKPKHGPTLLVRPLRRGDVRTVMAVFERLSESSRRARFNGPKPCLKTSELP
Ga0157369_1064326813300013105Corn RhizosphereMHTRILKPRHAPTLLVRPLRHRDTQTVLALFERLSDES
Ga0157378_1234619713300013297Miscanthus RhizosphereMHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGLKHR
Ga0157375_1039682743300013308Miscanthus RhizosphereMHTRVLKPKNGPTLLVRPLRRGDVGTVCAMFARLGERSRRAR
Ga0157375_1147150423300013308Miscanthus RhizosphereMHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGD
Ga0120149_124422413300014058PermafrostMYTRVIKPRHGPTLLVRPLERGDVATVSAVFEQLGEQSRRARFNGPK
Ga0157379_1212328633300014968Switchgrass RhizosphereMHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNASRLARFNGL
Ga0137412_1010061743300015242Vadose Zone SoilMHTRAIKLKHGPTILVRPLRAGDVATVRAVFEQLGDSSRRARFNGPKPCLSDAEL
Ga0132256_10046437733300015372Arabidopsis RhizosphereMHTRVVKAKHGPELVVRPLRHGDTATVQAVFERLGDAS
Ga0132257_10141919533300015373Arabidopsis RhizosphereMHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDES
Ga0132255_10196091923300015374Arabidopsis RhizosphereMHTRILESRHAPTLLVRPLRHRDVHTVLAVFERLSDESR
Ga0187809_1040660913300017937Freshwater SedimentMHTRVVKAKHGPELLVRPLRQGDTATVAAVFARLGDASRRARFNGL
Ga0187785_1056666913300017947Tropical PeatlandMRQALTDGSSSTRYLTPERGASVTARPLRHGDVRTVIGIFDRLSDRSRRYRFNGPKPCLS
Ga0187785_1066752623300017947Tropical PeatlandVHTRVLKSLGPALFVRPLRHGDTATVLAVFARLGEESRRARFNGAKPSLGESELRQLARVDG
Ga0184624_1037074813300018073Groundwater SedimentMHTRVIKPKLAPTLLVRPLRHGDVRTVWGLFERLG
Ga0206356_1166619123300020070Corn, Switchgrass And Miscanthus RhizosphereVHTRVITPKHGPSLVVRPLRDGDTATVLAVFERLGEASRRARFNG
Ga0126371_1101093533300021560Tropical Forest SoilMYTRIVKPKRGPEILIRPLRPGDTSTVEAVFERLGE
Ga0126371_1224045713300021560Tropical Forest SoilMHTRVVRTKRGPELIVRPLRRGDTATVQAVFDRLGADSRLARFN
Ga0207692_1095510323300025898Corn, Switchgrass And Miscanthus RhizosphereMVGISNRLMHTRVLHLKHGPALLVRPLRRGDVRTVMAVFERLGEASRRARFNGPKPCLRMSELRQLA
Ga0207707_1022569713300025912Corn RhizosphereMHTRVLRPKHGPTLLVRPLRHGDVRTVLAVFEQLGDESRRARFNGAKPCLSRTD
Ga0207671_1007298413300025914Corn RhizosphereMHTRVVKPTCGPELLIRPLKHGDTSTVEAMFGRLGDASRLARFNGLKHRL
Ga0207657_1069136423300025919Corn RhizosphereMQTRYLRLGRGPGLIVRPLRHGDAETVAAVFERLGESSRRN
Ga0207659_1031769823300025926Miscanthus RhizosphereMQTRHLRLGRGPGLIVRLLRHGDAETVAAVFERLGESSRRNRFNGPKP
Ga0207687_1010100143300025927Miscanthus RhizosphereMHTRVLKPKNGPTLLVRPLRRGDVGTVCAMFARLGERSRRA
Ga0207700_1024532613300025928Corn, Switchgrass And Miscanthus RhizosphereVYTRILTPEHCPTLIVRPLRNGDRATVLGVFERLGEQSRRAR
Ga0207690_1094897823300025932Corn RhizosphereMHTRILTPKHGPSLVVRPLRDGDATTVAAVFARLSAESRRLRFNGPKPCLPEAEL
Ga0207686_1025318833300025934Miscanthus RhizosphereMHTRVVKAKHGPELLVRPLRHGDTATVQAVFERLGDASRRAR
Ga0207669_1123460433300025937Miscanthus RhizosphereMHTRIVKPKRGLTLLVRPLRPGDTATVSAMFERLGEKSRRTRFNGPKPRLSAGDLE
Ga0207665_1010389613300025939Corn, Switchgrass And Miscanthus RhizosphereMHTRVVKPRCGPELLIRPLKHGDTSTVEAMFGRLGDASRLARFN
Ga0207665_1118931223300025939Corn, Switchgrass And Miscanthus RhizosphereMLSRLIKPPHGPSLIVRPLRDGDTRTVAAVFGRLSTESRRLRFNGPKPCLPDEELRL
Ga0207661_1110225813300025944Corn RhizosphereMHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGRLGERSRRT
Ga0207661_1111052813300025944Corn RhizosphereMQTRYLRLGRGPGLIVRPLRHGDAETVAAVFERLGESSRRNRFNGPKPRL
Ga0207702_1063570733300026078Corn RhizosphereMHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGRLGERSRRTRFN
Ga0209152_1010621833300026325SoilMHTRVLKPRNGPTLVVRPLRNGDVATVLSVFDRLGPQSRRTRFNGTKPC
Ga0209178_109311913300027725Agricultural SoilMHTRILTPKHGPSLVVRPLRDGDTATVVAVFARLSAESRRLRFNGPKPCLPEA
Ga0209579_1030933833300027869Surface SoilMHTRSLHLRDGRSLVVRPLRDGDLATVAAVFARVGPESRRARFNGPKPCTDA
Ga0209579_1034398033300027869Surface SoilMHTRALKPRHGPTILVRPLAHGDVRTVLAVFEQLSDASR
Ga0209814_1038362113300027873Populus RhizosphereMHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDESRRARFN
Ga0209465_1057469213300027874Tropical Forest SoilMHTRIVKPKHGPEIVVRPLRRGDTATVQAVFDRLGEASRVAR
Ga0307284_1049453113300028799SoilMYTRVLKPKRGPTLFVRPLRHGDLRTVVGLFERLGEQSRRARFNGPKPCLSRS
Ga0307310_1010584413300028824SoilVNTRVLKPRHGPTILVRPLRNGDVDAVLAVFHRLGEQSRRNRFNGPKTRL
Ga0307312_1048635513300028828SoilMHTRILKPKHGPALVVRPLRHGAARTVMDLFERLGEESRRTRFNGPKPCLSRSE
Ga0307314_1029041423300028872SoilVHTRIVKPKRGPALVVRPLRRGDTATVCAMFQRLGERS
Ga0170824_11637340813300031231Forest SoilMHTRVVKPKHGPERLVRPLRDGDTGTVQAVFERLGEASRLAR
Ga0318515_1015433813300031572SoilMMHTRAIKPKSGPPLLVRPLRNRDVETVLALFARLGDESRRLR
Ga0310907_1087497023300031847SoilMHARSIKARRGPELTVRLLRDGDVDTVLAVFERLGERSRRAR
Ga0318530_1037064513300031959SoilMHTRVVKPKRGPEMLVRPLRHGDVDTVWAVFSRLSEESRRTRFLGPKLELGD
Ga0308176_1256674523300031996SoilVHTRVITPKHGPSLVVRPLRDGDTATVLAVFERLGEASRRARFN
Ga0306922_1193179613300032001SoilMMHTRTIKPKSGPPLLVRPLRNRDVETVLALFARLGDESRRLRFNGP
Ga0318558_1008745913300032044SoilMHTRVVKPKRGPEMLVRPLRHGDVDTVWAVFSRLSEESRRTRFLGPK
Ga0308173_1039443533300032074SoilVHTRLISSRNGPTLLVRPLRDGDAATVLAVFERLGEASRRARFNGPKPCLS
Ga0308173_1227439513300032074SoilMQTRLITLKRGPRLIVRPLRNGDTATVLAVFGRLGADSRRLRFNGP
Ga0318525_1031346123300032089SoilMHTRIVKPKHGPEFLVRPLRHGDTATVQAVFERLGADSRRARFNGS
Ga0335082_1017845353300032782SoilMHTRIVRPRHGPELLVRPLRPGDTATVAAVFARLGDASRRARFNGLKHRLGEQE
Ga0335079_1133349313300032783SoilMHTRVLKPMRGATLLVRPLRHGDVRTVIAVFERLGEQSRRARFNGPKPCLTVS
Ga0335070_1106629513300032829SoilMHTRVLAPRHGPLLLVRPLRRGDERTVLDVFERLGEESRRARFNGP
Ga0335084_1136887423300033004SoilMQTRILKPKHGPTLLVRPLRNGDADTVLSVFERLGDRSRRSR
Ga0310810_1062096313300033412SoilMHTRILTPKQGPSLVVRPLRDGDTATVAAVFGRLSGESRRLRFNGPKPCLPDVELRHL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.