NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068552

Metagenome / Metatranscriptome Family F068552

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068552
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 45 residues
Representative Sequence KGIELILGLISKTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWGEK
Number of Associated Samples 105
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.23 %
% of genes near scaffold ends (potentially truncated) 94.35 %
% of genes from short scaffolds (< 2000 bps) 90.32 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.387 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(10.484 % of family members)
Environment Ontology (ENVO) Unclassified
(28.226 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.484 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.33%    β-sheet: 0.00%    Coil/Unstructured: 58.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF02776TPP_enzyme_N 33.87
PF09084NMT1 16.13
PF07883Cupin_2 5.65
PF00557Peptidase_M24 1.61
PF13379NMT1_2 1.61
PF02775TPP_enzyme_C 1.61
PF01243Putative_PNPOx 1.61
PF13531SBP_bac_11 0.81
PF14226DIOX_N 0.81
PF04392ABC_sub_bind 0.81
PF01609DDE_Tnp_1 0.81
PF02371Transposase_20 0.81
PF04909Amidohydro_2 0.81
PF04545Sigma70_r4 0.81
PF03308MeaB 0.81
PF06808DctM 0.81
PF13185GAF_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 16.13
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 16.13
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.81
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.81
COG3293TransposaseMobilome: prophages, transposons [X] 0.81
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.81
COG3547TransposaseMobilome: prophages, transposons [X] 0.81
COG5421TransposaseMobilome: prophages, transposons [X] 0.81
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.81
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.39 %
UnclassifiedrootN/A1.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459022|GZEQPF102H87ESAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
2209111006|2214798290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
2228664021|ICCgaii200_c0841349All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300001976|JGI24752J21851_1029848All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300002120|C687J26616_10054679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1374Open in IMG/M
3300003892|Ga0063012_10087053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300004022|Ga0055432_10129183All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300004024|Ga0055436_10307323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300004463|Ga0063356_101411444All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300004463|Ga0063356_102320692All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300005093|Ga0062594_101094202All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300005218|Ga0068996_10124573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300005294|Ga0065705_10630253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium689Open in IMG/M
3300005330|Ga0070690_100722710All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005332|Ga0066388_100349266All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2125Open in IMG/M
3300005332|Ga0066388_105677481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300005353|Ga0070669_101097605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300005356|Ga0070674_100184552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1600Open in IMG/M
3300005364|Ga0070673_101840853All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300005446|Ga0066686_10103242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1839Open in IMG/M
3300005446|Ga0066686_10812114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300005471|Ga0070698_100635624All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300005518|Ga0070699_102056174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300005543|Ga0070672_101919577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300005546|Ga0070696_100538341All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300005552|Ga0066701_10005443All Organisms → cellular organisms → Bacteria5286Open in IMG/M
3300005577|Ga0068857_102565894All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300005875|Ga0075293_1015348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium925Open in IMG/M
3300005937|Ga0081455_10597040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium720Open in IMG/M
3300006049|Ga0075417_10107539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1270Open in IMG/M
3300006844|Ga0075428_100123706All Organisms → cellular organisms → Bacteria2815Open in IMG/M
3300006847|Ga0075431_101255260All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006853|Ga0075420_100830267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium796Open in IMG/M
3300006854|Ga0075425_101485541All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300006914|Ga0075436_100052067All Organisms → cellular organisms → Bacteria2825Open in IMG/M
3300006914|Ga0075436_100152274All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300009100|Ga0075418_12543895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300009137|Ga0066709_103320225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300009147|Ga0114129_12267599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium652Open in IMG/M
3300009162|Ga0075423_11024318All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300009174|Ga0105241_12677471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300009177|Ga0105248_13099975All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300009691|Ga0114944_1302941All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300010029|Ga0105074_1041007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium805Open in IMG/M
3300010043|Ga0126380_11707114All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010047|Ga0126382_11626930All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300010358|Ga0126370_10123715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1838Open in IMG/M
3300010358|Ga0126370_12144745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300010362|Ga0126377_10143045All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2239Open in IMG/M
3300010362|Ga0126377_10663650All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300010362|Ga0126377_10946231All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium926Open in IMG/M
3300010362|Ga0126377_13417394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300010375|Ga0105239_10941200All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300010376|Ga0126381_102676216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300010398|Ga0126383_11432919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22780Open in IMG/M
3300010399|Ga0134127_10361957All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300010400|Ga0134122_10112742All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2168Open in IMG/M
3300012039|Ga0137421_1032244All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300012039|Ga0137421_1167299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300012039|Ga0137421_1236167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300012040|Ga0137461_1188190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300012202|Ga0137363_11208293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300012209|Ga0137379_11027647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300012401|Ga0134055_1359382Not Available1440Open in IMG/M
3300012685|Ga0137397_10259288All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300012685|Ga0137397_10344583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1110Open in IMG/M
3300012685|Ga0137397_10580447All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300012882|Ga0157304_1071176All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012922|Ga0137394_10247021All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300012931|Ga0153915_10538011All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1338Open in IMG/M
3300012931|Ga0153915_11621542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_62_17757Open in IMG/M
3300012948|Ga0126375_10002886All Organisms → cellular organisms → Bacteria → Proteobacteria6079Open in IMG/M
3300012971|Ga0126369_11343926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium805Open in IMG/M
3300012971|Ga0126369_12334654All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300012977|Ga0134087_10644342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300014268|Ga0075309_1203042All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300014270|Ga0075325_1229365All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300014861|Ga0180061_1055424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium656Open in IMG/M
3300015053|Ga0137405_1403425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2368Open in IMG/M
3300015245|Ga0137409_10118206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2444Open in IMG/M
3300015373|Ga0132257_100893502All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300015373|Ga0132257_102086363All Organisms → cellular organisms → Bacteria → Proteobacteria732Open in IMG/M
3300015374|Ga0132255_100672752All Organisms → cellular organisms → Bacteria1535Open in IMG/M
3300015374|Ga0132255_102102635All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300016270|Ga0182036_10328192All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300016445|Ga0182038_10196031All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300018054|Ga0184621_10193558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300018064|Ga0187773_10709535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300018064|Ga0187773_11171662All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300018066|Ga0184617_1047159All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300018075|Ga0184632_10330438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium656Open in IMG/M
3300018084|Ga0184629_10436586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300018084|Ga0184629_10683814All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300019878|Ga0193715_1070775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium732Open in IMG/M
3300019889|Ga0193743_1256479All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300022534|Ga0224452_1283925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300025160|Ga0209109_10018362All Organisms → cellular organisms → Bacteria → Proteobacteria3767Open in IMG/M
3300025313|Ga0209431_10088316Not Available2433Open in IMG/M
3300025319|Ga0209520_10556861All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300025322|Ga0209641_10249032All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300025324|Ga0209640_10202095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1688Open in IMG/M
3300025326|Ga0209342_10326755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1324Open in IMG/M
3300025905|Ga0207685_10097699All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300025937|Ga0207669_10568648All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300025939|Ga0207665_10448870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium989Open in IMG/M
3300026066|Ga0208290_1028821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300026298|Ga0209236_1107444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1247Open in IMG/M
3300026323|Ga0209472_1239212All Organisms → cellular organisms → Bacteria → Proteobacteria584Open in IMG/M
3300026324|Ga0209470_1048227All Organisms → cellular organisms → Bacteria2066Open in IMG/M
3300026529|Ga0209806_1274224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300027378|Ga0209981_1009548All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300027840|Ga0209683_10216849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium879Open in IMG/M
3300027874|Ga0209465_10053417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1936Open in IMG/M
3300028802|Ga0307503_10494065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300031719|Ga0306917_11206099All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300031854|Ga0310904_11184802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300031941|Ga0310912_10526979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium921Open in IMG/M
3300031941|Ga0310912_10582042All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300031942|Ga0310916_10736357All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300031949|Ga0214473_11238808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium770Open in IMG/M
3300032179|Ga0310889_10465323All Organisms → cellular organisms → Bacteria → Proteobacteria637Open in IMG/M
3300033813|Ga0364928_0008030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1904Open in IMG/M
3300034148|Ga0364927_0092882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300034150|Ga0364933_066618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium897Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.06%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil4.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.42%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.42%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.42%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.42%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.61%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.81%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediment0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.81%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459022Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition)EnvironmentalOpen in IMG/M
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300003892Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - CP Core 2, 1cmEnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027378Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA2_078683302170459022Grass SoilFIGKTVPQAATTKPEDFYDPRFFNDLRESGFLKKLWGDKL
22138266972209111006Arabidopsis RhizosphereTAMEKTLQVDPKGLELILEFIGKTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL
ICCgaii200_084134922228664021SoilQKGLELILEFIAKTVPQAASAKVEDFYDPRFTNELRNSGFLKQLWGDKL
JGI24752J21851_102984823300001976Corn, Switchgrass And Miscanthus RhizosphereMEKTLQIDPKGLELILEFIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL*
C687J26616_1005467913300002120SoilSKTVPQAASARPEDFYDPRFFNELKDSEFLKRLWGN*
Ga0063012_1008705313300003892Hot Spring SedimentDRALVVDPEGISFVLGQIKKTVPQAASAKPEDFFDPRFFTELQKSGFLKSLWGEH*
Ga0055432_1012918313300004022Natural And Restored WetlandsVERTLQIDPKGIELILTLMSKSMPQATSAKNEEFYDSRFTNELRDSGFLKRLWVEK*
Ga0055436_1030732323300004024Natural And Restored WetlandsTLMSKSMPQGPSVKTEEFYDSRFTNELRDSGFLKKLWGDKL*
Ga0063356_10141144433300004463Arabidopsis Thaliana RhizosphereLIAKSVPQAAAARPQDFFDSRFTADLRESGFLKRVWGETP*
Ga0063356_10232069213300004463Arabidopsis Thaliana RhizosphereILEFIAKTVPQAASAKVEDFYDPRFTNELRNSGFLKQLWGDKL*
Ga0062594_10109420213300005093SoilLLLGFIAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS*
Ga0068996_1012457313300005218Natural And Restored WetlandsLMSKSMPQGPSVKTEEFYDPRFTNELRDSGFLKKLWGER*
Ga0065705_1063025323300005294Switchgrass RhizosphereLALISKTVPQAASAKAEDFYDARFYTELRESGFLKKLWGEKP*
Ga0070690_10072271013300005330Switchgrass RhizosphereIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL*
Ga0066388_10034926613300005332Tropical Forest SoilKGIELILGLISKSVPQASSAKPADFYDPRFFNELRESGFLKRLWGDKL*
Ga0066388_10567748123300005332Tropical Forest SoilVERTLQVAPKGIELILGLISKSVPQAASAKAQDFYDPHFFTELRDSGFLKKLWGEQ*
Ga0070669_10109760513300005353Switchgrass RhizosphereKTLRVDPKGVELLLGFIAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS*
Ga0070674_10018455213300005356Miscanthus RhizosphereEFVGKSMPQSPSAKVEEFYDPRFTNELRNSGFLKQLWGEKL*
Ga0070673_10184085323300005364Switchgrass RhizospherePKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRESGFLKKLWGNKL*
Ga0066686_1010324233300005446SoilLWDPKGIELILGLIGKTVPQAASAKPEDFYVPRFFTELRDSGFLK
Ga0066686_1081211413300005446SoilKGIELILGLIGKTVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK*
Ga0070698_10063562413300005471Corn, Switchgrass And Miscanthus RhizosphereVDPKGLELILGLIGKTVPQAASTKPEDFYDPRFTNDLRDSGFLKKLWGENL*
Ga0070699_10205617423300005518Corn, Switchgrass And Miscanthus RhizosphereKGIELVLGLISKTVPQAASAKPEDFYDARFFTELKDSGFLKRLWGEN*
Ga0070672_10191957713300005543Miscanthus RhizosphereMEKTLQVDPKGLELILEFIGKTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL*
Ga0070696_10053834123300005546Corn, Switchgrass And Miscanthus RhizosphereILGFIGKTVPQAASAKPEDFYDPRFTNELRDSGFLKKLWGDK*
Ga0066701_1000544313300005552SoilQVEPKGIELILGLIGKTVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK*
Ga0068857_10256589413300005577Corn RhizosphereLQVDPKGIELILGLIGKSVSPGATARPQDFYDSRFSAELKDSGFLKRLWGETL*
Ga0075293_101534813300005875Rice Paddy SoilLILGLISKAVPQAASAKAEDFYDPRFFSELRDSGFLKKLWGNKL*
Ga0081455_1059704013300005937Tabebuia Heterophylla RhizosphereTPQATSAKAQDFYDPRFFNELRDSGFLKKLWAEK*
Ga0075417_1010753913300006049Populus RhizosphereLELILSLIGKTVPQAAATKPEDFYDPRFTNELRDSGFLKKLWGEK*
Ga0075428_10012370643300006844Populus RhizosphereVPQAASAKAEDFYDARFYTELRESGFLKRLWGEKP*
Ga0075431_10125526033300006847Populus RhizosphereELILALISKTVPQAASAKAEDFYDARFYNELRDSGFLKRLWGEKP*
Ga0075420_10083026713300006853Populus RhizosphereLISKTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWGEQ*
Ga0075425_10148554123300006854Populus RhizosphereLALISKTVPQAASAKAEDFYDARFYTELRESGFLKRLWGEKP*
Ga0075436_10005206743300006914Populus RhizosphereELILGLISKSVPQAVSAKAQDFYDPRFFTELRDSGFLKRLWGDKA*
Ga0075436_10015227413300006914Populus RhizosphereAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS*
Ga0075418_1254389513300009100Populus RhizosphereTVPQAASAKAEDFYDARFYNELRDSGFLKRLWGEKP*
Ga0066709_10332022523300009137Grasslands SoilVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK*
Ga0114129_1226759913300009147Populus RhizosphereTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWAEK*
Ga0075423_1102431813300009162Populus RhizosphereELILGLISKAVPQATSAKPEEFYDPRFFTELKESGFLKKLWGEN*
Ga0105241_1267747123300009174Corn RhizosphereLGLISKTVPQATSAKSEDFYDARFFSELKETGFLKTLWREN*
Ga0105248_1309997513300009177Switchgrass RhizosphereKTLQVDPKGLELILEFVGKSMPQSPSAKVEEFYDPRFTNELRNSGFLKQLWGEKL*
Ga0114944_130294113300009691Thermal SpringsPKGIELILEVISKTVPQAASAKPEDFYDSRFFTELKESGLLKRLWGER*
Ga0105074_104100723300010029Groundwater SandVPQAASAKAEDFYDPRFFTELRDSGFLKKLWAEK*
Ga0126380_1170711423300010043Tropical Forest SoilILTLISKTVPQAASAKAEDFYDARFYTELRDSGFLKRLWGDKP*
Ga0126382_1162693013300010047Tropical Forest SoilLQVDAKGLDLILGFISKTVPQAASAKPEDFYDPRFTNELRESGFLKKLWGEKL*
Ga0126370_1012371513300010358Tropical Forest SoilLILGLISKSVPQAASAKPEDFYDARFFTELKDSGFLKRVWAEN*
Ga0126370_1214474523300010358Tropical Forest SoilVERTLQVAPKGIELILGLISKSVPQAASAKAQDFYDPHFFTELRDSGFL
Ga0126377_1014304553300010362Tropical Forest SoilLISKTTPQAASAKAQDFYDPRFFTELRNSGFLKKLWAEK*
Ga0126377_1066365033300010362Tropical Forest SoilLISKTVPQAASAKAEDFYDARFYTELRDSGFLKRLWGEKP*
Ga0126377_1094623113300010362Tropical Forest SoilNRTAPQPFSAKPEDFYDARFTNDLRDSGFLKKLWGDK*
Ga0126377_1341739413300010362Tropical Forest SoilLISKSVPQAASAKAQDFYDPRFFNELRDSGFLKKLWGEQ*
Ga0105239_1094120013300010375Corn RhizosphereKTVPQATSAKSEDFYDARFFSELKETGFLKTLWREN*
Ga0126381_10267621613300010376Tropical Forest SoilAVQRSLEVDPKGVELILGLISKSVPQAASAKPEDFYDARFFTELKDSGFLKRVWAEN*
Ga0126383_1143291913300010398Tropical Forest SoilGIDLILGIIAKTVPQAASAKVEDFYDPRFSNELRESGFLKKLWGEK*
Ga0134127_1036195723300010399Terrestrial SoilDPKGVELLLGFIAKTVPQAGSAKAEEFYDPRFTNDLRESGFLKKLWGEKS*
Ga0134122_1011274213300010400Terrestrial SoilGLELILAFIAKTVPQAAIAKSEDFHDPRFTNEMKDSGYLKRLWGEN*
Ga0137421_103224413300012039SoilVPQAASAKAEDFYDARFYTELRDSGFLKKLWGEKP*
Ga0137421_116729913300012039SoilVDPKDIELILGLIANSLLQAPSARAQDFYDSRFSADLRDSGFLKRLWGES*
Ga0137421_123616723300012039SoilLVWIKHGIELILGLIGKSVPQAATARPQDFYDSRFTTDLRDSGFLKRLWGEAL*
Ga0137461_118819013300012040SoilDPKGIELILGLIAKSVPQAASARAQDFYDSRFSADLKDSGFLKRLWGES*
Ga0137363_1120829323300012202Vadose Zone SoilILGLIAKTVPQAASAKPEDFYDPRFFAELRDSGFLKGLWGEK*
Ga0137379_1102764723300012209Vadose Zone SoilQVDPKGLELILSLIGKTVPQAAATKPEDFYDPRFTNELRDSGFLNKLWGEKL*
Ga0134055_135938233300012401Grasslands SoilGKTVPQAASAKPEDFYVPRFFTELRDSGFLKRLWGES*
Ga0137397_1025928813300012685Vadose Zone SoilTVPQAASAKPEDFYDARFYTELRDSGFLKRLWGEKP*
Ga0137397_1034458313300012685Vadose Zone SoilDPKGIELILGLIGKTVPQAASAKAEDFYDLRFTTELRESGFLKRLWGEKL*
Ga0137397_1058044713300012685Vadose Zone SoilTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL*
Ga0157304_107117613300012882SoilDPKGLELILEFIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL*
Ga0137394_1024702113300012922Vadose Zone SoilPQAASAKAEDFYDARFYTELRDSGFLKRLWGEKP*
Ga0153915_1053801113300012931Freshwater WetlandsILGLIGKTVPQAASAKPEEFYDSRFFTELKDSGFLKRLWGEH*
Ga0153915_1162154223300012931Freshwater WetlandsELILGLIGKTVPQAASAKPEEFYDSRFFTELKDSGFLKRLWGEN*
Ga0126375_1000288673300012948Tropical Forest SoilMEKTLQIDPKGIDLILGIIAKTVPQAASAKVEDFYDPRFSNELRDSGFLKKLWGEN*
Ga0126369_1134392633300012971Tropical Forest SoilILTLISKTVPQAASAKTEDFYDARFYTELRDSGFLKRLWGEKP*
Ga0126369_1233465423300012971Tropical Forest SoilKGLELILEFIAKTVPQAASAKPEDFYDSRFINDLRGSGFLKKLWGEKL*
Ga0134087_1064434213300012977Grasslands SoilGKTVPQAAATKPEDFYDPRFTNELRDSGFLKKLWGEKL*
Ga0075309_120304213300014268Natural And Restored WetlandsKGIELILGLIRKTVPQAASAKAEDFYDARFFTELRESGFLKRLKGEKS*
Ga0075325_122936523300014270Natural And Restored WetlandsLQVDPKGIELVLGLIRKTVPQAASAKADDFYDARFFTELRESGFLKRLKGEKS*
Ga0180061_105542413300014861SoilLIAKSVPQAAAARPQDFYDSRFTADLRDSGFLKRLWGEAL*
Ga0137405_140342533300015053Vadose Zone SoilLISKTVPQAASAKPEDFYDARFYTELRDSGFLKRLWGEKP*
Ga0137409_1011820613300015245Vadose Zone SoilMAVERTLQVDPKGIELILGLISKTVPQAASAKAEDFYDPRFFN
Ga0132257_10089350213300015373Arabidopsis RhizosphereTLRVDPKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRESGFLKKLWGNKL*
Ga0132257_10208636323300015373Arabidopsis RhizosphereTLRVDPKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRDSGFLKKLWG*
Ga0132255_10067275213300015374Arabidopsis RhizosphereLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRDSGFLKKLWG*
Ga0132255_10210263523300015374Arabidopsis RhizosphereQVDPKGLELILEFIGKTVPQAASTKPEDFYDPRFFNDLRESGFLKKLWGDKL*
Ga0182036_1032819223300016270SoilELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL
Ga0182038_1019603113300016445SoilDPKGVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL
Ga0184621_1019355813300018054Groundwater SedimentRTLQVDPKWIELILALISKTVPQAASAKPEDFYDARFYTELRDSGFLKRLWGEKP
Ga0187773_1070953513300018064Tropical PeatlandIGKTVPQAASAKPEDFYDPRFFNELRDSGFLKKLWGEK
Ga0187773_1117166213300018064Tropical PeatlandNPKGLEQILAFIAKTVPQAASAKPEDFYDLRFTNELRDSGFLKRLWGES
Ga0184617_104715923300018066Groundwater SedimentILGLISKSLPQAASAKPQDFYDPRFAAELRDSGFLKRLWGAKL
Ga0184632_1033043823300018075Groundwater SedimentPKGIELILGLISKSVPQAASAKPEDFYDPRFFNELRDSGFLKKLWGEKY
Ga0184629_1043658613300018084Groundwater SedimentKDIELILGLIANSLLQAPSARAQDFYDSRFSADLRDSGFLKRLWGES
Ga0184629_1068381413300018084Groundwater SedimentTLQVDSKGVELILGFIGNTVPQAASAKPEDFYDPRFTNDLRDSGFLKRLWGEK
Ga0193715_107077523300019878SoilPKGIELILALIGKTVPQAASAKAEDFYDARFTTELRDSGFLKKLWGDKL
Ga0193743_125647913300019889SoilLILGLISKSLPQAASAKPQDFYDPRFAAELRDSGFLKRLWGDKL
Ga0224452_128392523300022534Groundwater SedimentILALINKSMPLAHSVKTEEFYDSRFTNELRDSGFLKRLWGEKL
Ga0209109_1001836243300025160SoilSKTVPQAASARPEDFYDPRFFNELKDSEFLKRLWGN
Ga0209431_1008831633300025313SoilMSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL
Ga0209520_1055686113300025319SoilLMSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL
Ga0209641_1024903213300025322SoilSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL
Ga0209640_1020209513300025324SoilPKGIELILGLMSKSMPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGEK
Ga0209342_1032675533300025326SoilIKGKIPQAATAKAEEFYDPRFFTELRESGFLKSLWGEN
Ga0207685_1009769923300025905Corn, Switchgrass And Miscanthus RhizosphereAMEKTLRVDPKGVELLLGFIAKTVPQAGSAKPEEFYDPRFTNDLRESGFLKKLWGNKL
Ga0207669_1056864833300025937Miscanthus RhizosphereEFIGKTVPQAASAKPEDFYDSRFVNDLRTSGLLKKLWGDKL
Ga0207665_1044887023300025939Corn, Switchgrass And Miscanthus RhizosphereILALIGKTVPQAASAKAEDFYDARFTTELRDSGFLKKLWGDKL
Ga0208290_102882133300026066Natural And Restored WetlandsLGLISKAVPQAASAKAEDFYDPRFFSELRDSGFLKKLWGNKP
Ga0209236_110744413300026298Grasslands SoilTVPQAASAKAEDFYDTRFTADLKDSGFLKRLWGEK
Ga0209472_123921213300026323SoilLQVDPKGIDLILGLIGKTVPQAASAKPEDFFDARFTTELRDSGFLKRLWGDKL
Ga0209470_104822713300026324SoilSLIGKTVPQAAATKPEDFYDRRFTNELRDSGFLKKLWGEKL
Ga0209806_127422413300026529SoilGKTVPQAASAKPEDFFDARFTTELRDSGFLKRLWGDKL
Ga0209981_100954823300027378Arabidopsis Thaliana RhizospherePKGIELILGLISKSVPQAASAKAEDFYDPRFFTELRDSGFLKKLWGDKL
Ga0209683_1021684923300027840Wetland SedimentKSMPQAISAKPEDFYDPRFSNDLRDSAFLKKLWGEK
Ga0209465_1005341733300027874Tropical Forest SoilVERTLQVAPKGIELILGLISKSVPQAASAKAQDFYDPHFFTELRDSG
Ga0307503_1049406513300028802SoilGKSVPQAASAKPEDFYDGRFTNELKDSGFLKRLWGEN
Ga0306917_1120609913300031719SoilKTLQVDPKGVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL
Ga0310904_1118480223300031854SoilKGIELILGLISKSVPQAGSAKAQDFYDPRFVNELRDSGFLKKLWADK
Ga0310912_1052697913300031941SoilVDPKGVELILGLISKTVPQAASAKPEDFYDARFFTELKDSGFLKRLWGEN
Ga0310912_1058204213300031941SoilTLQVDPKGVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL
Ga0310916_1073635713300031942SoilVELLLGFIGKTVPQAASAKLEDFYDPRFTNDLRDSGFLKKLWGEKL
Ga0214473_1123880813300031949SoilILGLMSKSLPQAASAKPEDFYDPRFFTDLRDSGFLKKLWGDKL
Ga0310889_1046532313300032179SoilEVNPKGLELILAFIAKTVPQAATAKSEDFYDPRFTNEMRDSGFLKRLWGES
Ga0364928_0008030_1773_18893300033813SedimentMSKSMPQAASAKPEDFYDPRFFTDLRDSGFLKKLWSEK
Ga0364927_0092882_711_8303300034148SedimentLISKTVPQAASAKAEDFYDPRFSNELRDSGFLKKLWGEK
Ga0364933_066618_753_8963300034150SedimentKGIELILGLISKTVPQAASAKAEDFYDPRFFNELRDSGFLKKLWGEK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.