Basic Information | |
---|---|
Family ID | F068767 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 47 residues |
Representative Sequence | MCATCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSITKATPKKPKK |
Number of Associated Samples | 71 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 25.81 % |
% of genes near scaffold ends (potentially truncated) | 18.55 % |
% of genes from short scaffolds (< 2000 bps) | 69.35 % |
Associated GOLD sequencing projects | 63 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (41.129 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.710 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.839 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF13252 | DUF4043 | 3.23 |
PF01391 | Collagen | 1.61 |
PF01464 | SLT | 1.61 |
PF00535 | Glycos_transf_2 | 0.81 |
PF01551 | Peptidase_M23 | 0.81 |
PF13155 | Toprim_2 | 0.81 |
PF13884 | Peptidase_S74 | 0.81 |
PF13704 | Glyco_tranf_2_4 | 0.81 |
PF06737 | Transglycosylas | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.87 % |
Unclassified | root | N/A | 41.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10096962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300001968|GOS2236_1087726 | Not Available | 1509 | Open in IMG/M |
3300002202|metazooDRAFT_1275844 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
3300002471|metazooDRAFT_1483652 | Not Available | 871 | Open in IMG/M |
3300002835|B570J40625_100968995 | Not Available | 729 | Open in IMG/M |
3300003490|JGI25926J51410_1002572 | Not Available | 3699 | Open in IMG/M |
3300004240|Ga0007787_10284433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 816 | Open in IMG/M |
3300005527|Ga0068876_10001521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18122 | Open in IMG/M |
3300005527|Ga0068876_10254494 | Not Available | 1006 | Open in IMG/M |
3300005527|Ga0068876_10643360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 571 | Open in IMG/M |
3300005581|Ga0049081_10002865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6507 | Open in IMG/M |
3300005581|Ga0049081_10045342 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
3300005805|Ga0079957_1000516 | Not Available | 34625 | Open in IMG/M |
3300005805|Ga0079957_1033537 | All Organisms → Viruses → Predicted Viral | 3364 | Open in IMG/M |
3300006639|Ga0079301_1007316 | All Organisms → Viruses → Predicted Viral | 4316 | Open in IMG/M |
3300006639|Ga0079301_1228043 | Not Available | 527 | Open in IMG/M |
3300007162|Ga0079300_10168970 | Not Available | 584 | Open in IMG/M |
3300007538|Ga0099851_1132158 | Not Available | 938 | Open in IMG/M |
3300007538|Ga0099851_1183464 | Not Available | 767 | Open in IMG/M |
3300007541|Ga0099848_1044696 | Not Available | 1802 | Open in IMG/M |
3300007541|Ga0099848_1072428 | Not Available | 1354 | Open in IMG/M |
3300008107|Ga0114340_1013108 | All Organisms → Viruses → Predicted Viral | 4048 | Open in IMG/M |
3300008107|Ga0114340_1016442 | All Organisms → cellular organisms → Bacteria | 3538 | Open in IMG/M |
3300008107|Ga0114340_1028145 | All Organisms → Viruses → Predicted Viral | 2596 | Open in IMG/M |
3300008107|Ga0114340_1039753 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
3300008107|Ga0114340_1054584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1737 | Open in IMG/M |
3300008107|Ga0114340_1105576 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
3300008107|Ga0114340_1225697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 597 | Open in IMG/M |
3300008108|Ga0114341_10002860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16395 | Open in IMG/M |
3300008110|Ga0114343_1011671 | All Organisms → Viruses → Predicted Viral | 4232 | Open in IMG/M |
3300008110|Ga0114343_1089681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300008110|Ga0114343_1111288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C1161 | 931 | Open in IMG/M |
3300008110|Ga0114343_1119073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C1161 | 887 | Open in IMG/M |
3300008113|Ga0114346_1213026 | Not Available | 758 | Open in IMG/M |
3300008114|Ga0114347_1009153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7230 | Open in IMG/M |
3300008114|Ga0114347_1021219 | Not Available | 5157 | Open in IMG/M |
3300008114|Ga0114347_1065301 | All Organisms → Viruses → Predicted Viral | 1501 | Open in IMG/M |
3300008114|Ga0114347_1265363 | Not Available | 515 | Open in IMG/M |
3300008116|Ga0114350_1028761 | Not Available | 2217 | Open in IMG/M |
3300008116|Ga0114350_1068606 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
3300008116|Ga0114350_1084406 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
3300008116|Ga0114350_1137786 | Not Available | 704 | Open in IMG/M |
3300008116|Ga0114350_1161687 | Not Available | 606 | Open in IMG/M |
3300008117|Ga0114351_1244210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 897 | Open in IMG/M |
3300008118|Ga0114352_1110906 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
3300008120|Ga0114355_1068630 | Not Available | 1516 | Open in IMG/M |
3300008120|Ga0114355_1095758 | Not Available | 1180 | Open in IMG/M |
3300008120|Ga0114355_1235446 | Not Available | 551 | Open in IMG/M |
3300008258|Ga0114840_1014545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 2806 | Open in IMG/M |
3300008264|Ga0114353_1222082 | Not Available | 868 | Open in IMG/M |
3300008266|Ga0114363_1075044 | Not Available | 1274 | Open in IMG/M |
3300008266|Ga0114363_1212884 | Not Available | 973 | Open in IMG/M |
3300008448|Ga0114876_1031286 | All Organisms → Viruses → Predicted Viral | 2600 | Open in IMG/M |
3300008450|Ga0114880_1114387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1022 | Open in IMG/M |
3300008450|Ga0114880_1243548 | Not Available | 567 | Open in IMG/M |
3300009081|Ga0105098_10135030 | Not Available | 1095 | Open in IMG/M |
3300009165|Ga0105102_10226358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 944 | Open in IMG/M |
3300009183|Ga0114974_10182766 | Not Available | 1292 | Open in IMG/M |
3300009419|Ga0114982_1022486 | Not Available | 2088 | Open in IMG/M |
3300010885|Ga0133913_12123534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1389 | Open in IMG/M |
3300011116|Ga0151516_10490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19393 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10003657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19667 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10086024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2296 | Open in IMG/M |
3300017722|Ga0181347_1126091 | Not Available | 713 | Open in IMG/M |
3300017736|Ga0181365_1028740 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
3300019784|Ga0181359_1217040 | Not Available | 604 | Open in IMG/M |
3300019784|Ga0181359_1251120 | Not Available | 536 | Open in IMG/M |
3300020506|Ga0208091_1015858 | Not Available | 901 | Open in IMG/M |
3300021141|Ga0214163_1114084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 613 | Open in IMG/M |
3300022179|Ga0181353_1155223 | Not Available | 524 | Open in IMG/M |
3300022190|Ga0181354_1069660 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
3300022190|Ga0181354_1144666 | Not Available | 748 | Open in IMG/M |
3300022198|Ga0196905_1005389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4499 | Open in IMG/M |
3300022198|Ga0196905_1024352 | Not Available | 1866 | Open in IMG/M |
3300022198|Ga0196905_1056075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
3300025646|Ga0208161_1028273 | Not Available | 2003 | Open in IMG/M |
3300025647|Ga0208160_1155395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 550 | Open in IMG/M |
3300025655|Ga0208795_1181526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 505 | Open in IMG/M |
3300027114|Ga0208009_1009487 | All Organisms → Viruses → Predicted Viral | 2439 | Open in IMG/M |
3300027468|Ga0209247_1060125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 557 | Open in IMG/M |
3300027518|Ga0208787_1000743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14880 | Open in IMG/M |
3300027518|Ga0208787_1021503 | All Organisms → Viruses → Predicted Viral | 2083 | Open in IMG/M |
3300027608|Ga0208974_1000128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 32998 | Open in IMG/M |
3300027710|Ga0209599_10017238 | All Organisms → Viruses → Predicted Viral | 2080 | Open in IMG/M |
3300027744|Ga0209355_1149969 | Not Available | 999 | Open in IMG/M |
3300027759|Ga0209296_1110073 | Not Available | 1299 | Open in IMG/M |
3300027785|Ga0209246_10076935 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
3300027804|Ga0209358_10502559 | Not Available | 551 | Open in IMG/M |
3300027808|Ga0209354_10208866 | Not Available | 791 | Open in IMG/M |
3300027956|Ga0209820_1017941 | Not Available | 1793 | Open in IMG/M |
3300028025|Ga0247723_1001140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16050 | Open in IMG/M |
3300028025|Ga0247723_1029300 | Not Available | 1754 | Open in IMG/M |
3300028025|Ga0247723_1061215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1040 | Open in IMG/M |
3300031758|Ga0315907_10003869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17206 | Open in IMG/M |
3300031758|Ga0315907_10057455 | Not Available | 3401 | Open in IMG/M |
3300031758|Ga0315907_10127507 | All Organisms → Viruses → Predicted Viral | 2168 | Open in IMG/M |
3300031758|Ga0315907_10237155 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
3300031758|Ga0315907_10289428 | All Organisms → Viruses → Predicted Viral | 1347 | Open in IMG/M |
3300031758|Ga0315907_10426789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
3300031758|Ga0315907_10694772 | Not Available | 774 | Open in IMG/M |
3300031758|Ga0315907_10741956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 741 | Open in IMG/M |
3300031758|Ga0315907_10902312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C1161 | 648 | Open in IMG/M |
3300031784|Ga0315899_10766883 | Not Available | 887 | Open in IMG/M |
3300031787|Ga0315900_10011206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11129 | Open in IMG/M |
3300031857|Ga0315909_10089548 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
3300031857|Ga0315909_10265910 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
3300031857|Ga0315909_10394735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
3300031857|Ga0315909_10799583 | Not Available | 596 | Open in IMG/M |
3300031857|Ga0315909_10860802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 564 | Open in IMG/M |
3300031857|Ga0315909_10905987 | Not Available | 543 | Open in IMG/M |
3300031857|Ga0315909_10915036 | Not Available | 539 | Open in IMG/M |
3300031951|Ga0315904_10006396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16130 | Open in IMG/M |
3300031951|Ga0315904_10099033 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
3300031951|Ga0315904_10394521 | Not Available | 1256 | Open in IMG/M |
3300032050|Ga0315906_10627883 | Not Available | 878 | Open in IMG/M |
3300032093|Ga0315902_10996587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 630 | Open in IMG/M |
3300032093|Ga0315902_11194941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 547 | Open in IMG/M |
3300032093|Ga0315902_11273933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 521 | Open in IMG/M |
3300033993|Ga0334994_0307432 | Not Available | 802 | Open in IMG/M |
3300034061|Ga0334987_0135607 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
3300034061|Ga0334987_0138033 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
3300034062|Ga0334995_0170099 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
3300034122|Ga0335060_0583257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 565 | Open in IMG/M |
3300034272|Ga0335049_0023491 | All Organisms → Viruses → Predicted Viral | 4629 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 25.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 20.16% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.71% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.06% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.45% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 6.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.42% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.42% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.42% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.42% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.42% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.61% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.61% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.81% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008118 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTR | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100969621 | 3300000756 | Freshwater And Sediment | RNNMCTTCGCNYPNLEHAMANAKGNNPMGMPIAPVPSSIQKAEPKKPKGK* |
GOS2236_10877263 | 3300001968 | Marine | MCTTCGCNYPNVDHPMANAKGDNSMEPIKPVPSSIVKATPKKPGK* |
metazooDRAFT_12758441 | 3300002202 | Lake | LRLENQEEVNIMCTTCGCNYPNIKHPMANAMGDNPIENIEPVPSSIEKVQPRKPKGK* |
metazooDRAFT_14836523 | 3300002471 | Lake | MCTTCGCNYPNIKHPMANAMGDNPIENIEPVPSSIEKVQPRKPKGK* |
B570J40625_1009689952 | 3300002835 | Freshwater | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKATPKKPKGK* |
JGI25926J51410_10025724 | 3300003490 | Freshwater Lake | MXTTCGCNYVNLDHAMANSKGDNPMGMPIAPMPSSIVKAVPKKPKK* |
Ga0007787_102844331 | 3300004240 | Freshwater Lake | MCATCGCNYPTIDHPMANAKGDNEMKPISPMPSSIVKATPKQPKK* |
Ga0068876_100015212 | 3300005527 | Freshwater Lake | MCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSSIQTATPKKPGK* |
Ga0068876_102544943 | 3300005527 | Freshwater Lake | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSITKATPKKPKK* |
Ga0068876_106433604 | 3300005527 | Freshwater Lake | MCATCGCNYPNLEHSMANAMGNNPMGMPIAPKPSSIRKAEP |
Ga0049081_1000286510 | 3300005581 | Freshwater Lentic | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKAVPKKPKGK* |
Ga0049081_100453426 | 3300005581 | Freshwater Lentic | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPVPSSIQKAEPKKPKGK* |
Ga0079957_100051619 | 3300005805 | Lake | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKAVPKKPKGK* |
Ga0079957_10335374 | 3300005805 | Lake | MCATCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIQTAVPKKPKK* |
Ga0079301_10073162 | 3300006639 | Deep Subsurface | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIQTATPKKPKK* |
Ga0079301_12280432 | 3300006639 | Deep Subsurface | MCTTCGCNYPNVDHSMANAKGKNETAYINPVPSSIEKATPKKPKK* |
Ga0079300_101689701 | 3300007162 | Deep Subsurface | GCNYPNLDHAMANAKGDNPMGMPIAPKPSSIQTAVPKKPKK* |
Ga0099851_11321585 | 3300007538 | Aqueous | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIVKATPKKPKK* |
Ga0099851_11834643 | 3300007538 | Aqueous | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIKKATPKQPKK* |
Ga0099848_10446963 | 3300007541 | Aqueous | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIEKATPKKPGK* |
Ga0099848_10724284 | 3300007541 | Aqueous | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPQPSSIETATPKKPKK* |
Ga0114340_10131084 | 3300008107 | Freshwater, Plankton | MCATCGCNYPTLEHAMANDMGDNPMGMPIAPKPSSIEKAVPKKPKGK* |
Ga0114340_10164426 | 3300008107 | Freshwater, Plankton | MCATCGCNYPNLDHAMANAMGNNPMGMPIAPKPSSIVKATPKKPKK* |
Ga0114340_10281455 | 3300008107 | Freshwater, Plankton | MCATCGCNYPNLDHAMANDMGDNPMGMPIAPKPSSIVKATPKKPKK* |
Ga0114340_10397533 | 3300008107 | Freshwater, Plankton | MCATCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIETAVPKKPKGK* |
Ga0114340_10545842 | 3300008107 | Freshwater, Plankton | MCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSSIEKATPKKPGK* |
Ga0114340_11055764 | 3300008107 | Freshwater, Plankton | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIETAVPKKPKGK* |
Ga0114340_12256971 | 3300008107 | Freshwater, Plankton | MCTTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIQSATPKKPKK* |
Ga0114341_1000286015 | 3300008108 | Freshwater, Plankton | MCTTCGCNYPNVDHAMANAMGDNPMGMPIAPKPSSIVKATPKKPKK* |
Ga0114343_10116715 | 3300008110 | Freshwater, Plankton | MCATCGCNYPNLDHSMANAMGNNPMGMPIAPKPSSIVKATPKKPKK* |
Ga0114343_10896815 | 3300008110 | Freshwater, Plankton | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIETAVPKKPKGK |
Ga0114343_11112883 | 3300008110 | Freshwater, Plankton | MCATCGCNYPNLDHAMANAMGNNPMGMPIAPKPSSIVKATPKKPKGK* |
Ga0114343_11190732 | 3300008110 | Freshwater, Plankton | MCATCGCNYPNLEHSMANAMGNNPMGMPIAPKPSSIQKAEPKKPKGK* |
Ga0114346_12130261 | 3300008113 | Freshwater, Plankton | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIQTATPKKPGK* |
Ga0114347_100915312 | 3300008114 | Freshwater, Plankton | MCATCGCNYPNLDHAMANSKGDNPMGMPIAPMPSSIQTAVPKKPKK* |
Ga0114347_10212195 | 3300008114 | Freshwater, Plankton | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKATPKQPKK* |
Ga0114347_10653014 | 3300008114 | Freshwater, Plankton | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIVKATPKQPKK* |
Ga0114347_12653631 | 3300008114 | Freshwater, Plankton | VNNMCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSSIEKATPKKPGK* |
Ga0114350_10287613 | 3300008116 | Freshwater, Plankton | MCTTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIQKPAPKKPKK* |
Ga0114350_10686063 | 3300008116 | Freshwater, Plankton | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIVKAEPKKPKGK* |
Ga0114350_10844062 | 3300008116 | Freshwater, Plankton | MCATCGCNYPNLEHSMANAMGDNPMGMPIAPKPSSIQKAEPKKPKGK* |
Ga0114350_11377863 | 3300008116 | Freshwater, Plankton | MCSTCGCNYPNIDHAMANAKGDNPMGMPIAPKPSSIE |
Ga0114350_11616873 | 3300008116 | Freshwater, Plankton | MCATCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIVKATPKKPKK* |
Ga0114351_12442102 | 3300008117 | Freshwater, Plankton | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKSSSIEKATPKQPKK* |
Ga0114352_11109061 | 3300008118 | Freshwater, Plankton | MCSTCVCNYPNVDHAMANAKGDNPMGMPIAPKPSSIEKATPQK |
Ga0114355_10686301 | 3300008120 | Freshwater, Plankton | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIQKPAPKKPKK* |
Ga0114355_10957582 | 3300008120 | Freshwater, Plankton | MLKNKQKEVKNNMCSTCGCNYPNIDHAMANAKGDNPMGMPIAPKPSSIEKATPKKPGK* |
Ga0114355_12354463 | 3300008120 | Freshwater, Plankton | MCATCGCNYPNLEHAMANAMGDNPMGMPIAPKPSSIVKATPKKPKGK* |
Ga0114840_10145453 | 3300008258 | Freshwater, Plankton | MCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSTKPSSIEKATPKKPGK* |
Ga0114353_12220821 | 3300008264 | Freshwater, Plankton | ATCGCNYPNLEHSMANAMGNNPMGMPIAPKPSSIQKAEPKKPKGK* |
Ga0114363_10750445 | 3300008266 | Freshwater, Plankton | MCATCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIQTATPKKPKK* |
Ga0114363_12128842 | 3300008266 | Freshwater, Plankton | MCSTCGCNYPNVDHAMANAKADDPMGMPIAPKPSSIEKATPKKPGK* |
Ga0114876_10312865 | 3300008448 | Freshwater Lake | MCATCGCNYPTLEHAMANDMGDNPMGMPIAPKPSSMEKAVPKKPKGK* |
Ga0114880_11143874 | 3300008450 | Freshwater Lake | MCTTCGCNYPNLDHAMANAKGNNPMGMPIAPKPSSIVKAEPKKPKGK* |
Ga0114880_12435481 | 3300008450 | Freshwater Lake | CGCNYPNLEHSMANAMGNNPMGMPIAPKPSSIQKAEPKKPKGK* |
Ga0105098_101350301 | 3300009081 | Freshwater Sediment | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIQKATPKKPKGK* |
Ga0105102_102263583 | 3300009165 | Freshwater Sediment | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIVKATPKKPKGK* |
Ga0114974_101827663 | 3300009183 | Freshwater Lake | MCSTCGCNYPNVDHSMANSKGDNPMGMPIAPKPSSIEKATPKKPGK* |
Ga0114982_10224864 | 3300009419 | Deep Subsurface | MCATCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSITKATPKKPKK* |
Ga0133913_121235344 | 3300010885 | Freshwater Lake | MCATCGCNYINLEHSMANAKGENPMGMPMSPKTSSIVKATPKKPKK* |
Ga0151516_1049013 | 3300011116 | Freshwater | MCATCGCNYPNLDHAMANSKGDNPMGMPIAPMPSSIQTATPKKPKK* |
(restricted) Ga0172367_1000365717 | 3300013126 | Freshwater | MCSTCGCNYPNVDHAMANAKGDNSMDVIKPIPSSIVKASPKKPKK* |
(restricted) Ga0172376_100860242 | 3300014720 | Freshwater | MCTTCGCNYPNLNHPMANAKGDNSMENISPVPSSIEKATPKKPKK* |
Ga0181347_11260912 | 3300017722 | Freshwater Lake | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPVPSSIVTAVPNKPKGK |
Ga0181365_10287404 | 3300017736 | Freshwater Lake | MCTTCGCNYVNLDHAMANSKGDNPMGMPIAPMPSSIVKAVPKKPKK |
Ga0181359_12170402 | 3300019784 | Freshwater Lake | MCTTCGCNYPNLEHAMANAKGNNPIGMPLAPVPSSIEKAVPKKPKK |
Ga0181359_12511202 | 3300019784 | Freshwater Lake | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPVPSSIETAVPKKPKK |
Ga0208091_10158584 | 3300020506 | Freshwater | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIETAVPKKPKGK |
Ga0214163_11140841 | 3300021141 | Freshwater | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKAVPKKPKGK |
Ga0181353_11552232 | 3300022179 | Freshwater Lake | MCATCGCNYPNLDHAMANAMGDNPMGMPIAPKPSSIQKAEPKKPKGK |
Ga0181354_10696605 | 3300022190 | Freshwater Lake | MCSTCGCNYPNVDHSMANAKGDNPMGMPIAPKPSSITKATPKKPKK |
Ga0181354_11446663 | 3300022190 | Freshwater Lake | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPVPSSIETAVPKKPKGK |
Ga0196905_10053898 | 3300022198 | Aqueous | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIKKATPKQPKK |
Ga0196905_10243524 | 3300022198 | Aqueous | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIEKATPKKPGK |
Ga0196905_10560751 | 3300022198 | Aqueous | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPQPSSIETATPKKPKK |
Ga0208161_10282732 | 3300025646 | Aqueous | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIVKATPKKPKK |
Ga0208160_11553953 | 3300025647 | Aqueous | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIKKATPKQPKK |
Ga0208795_11815263 | 3300025655 | Aqueous | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIKKATPKQPKK |
Ga0208009_10094872 | 3300027114 | Deep Subsurface | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIQTATPKKPKK |
Ga0209247_10601253 | 3300027468 | Freshwater Lake | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPVPSSIETAVPNKPKGK |
Ga0208787_100074310 | 3300027518 | Deep Subsurface | MCTTCGCNYPNVDHSMANAKGKNETAYINPVPSSIEKATPKKPKK |
Ga0208787_10215031 | 3300027518 | Deep Subsurface | RNNMCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIQTAVPKKPKK |
Ga0208974_10001288 | 3300027608 | Freshwater Lentic | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPVPSSIQKAEPKKPKGK |
Ga0209599_100172383 | 3300027710 | Deep Subsurface | MCATCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSITKATPKKPKK |
Ga0209355_11499695 | 3300027744 | Freshwater Lake | QERRNNMCTTCGCNYPNLEHAMANAKGDNPMGMPIAPVPSSIETAVPKKPKK |
Ga0209296_11100733 | 3300027759 | Freshwater Lake | MCSTCGCNYPNVDHSMANSKGDNPMGMPIAPKPSSIEKATPKKPGK |
Ga0209246_100769351 | 3300027785 | Freshwater Lake | KRNQKLSQRKWERRNSMCTTCGCNYVNLDHAMANSKGDNPMGMPIAPMPSSIVKAVPKKPKK |
Ga0209358_105025591 | 3300027804 | Freshwater Lake | MCATCGCNYPTIDHPMANAKGDNEMKPISPMPSSIVKATPKQPKK |
Ga0209354_102088663 | 3300027808 | Freshwater Lake | NMCTTCGCNYPNLEHAMANAKGDNPMGMPIAPVPSSIVTAVPNKPKGK |
Ga0209820_10179412 | 3300027956 | Freshwater Sediment | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIQKATPKKPKGK |
Ga0247723_100114014 | 3300028025 | Deep Subsurface Sediment | MCATCGCNYPNLDHAMANAMGDNPMGMPIAPKPSSIVKATPKKPKGK |
Ga0247723_10293004 | 3300028025 | Deep Subsurface Sediment | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKAVPKKPKGK |
Ga0247723_10612152 | 3300028025 | Deep Subsurface Sediment | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIEKAVPKKPKGK |
Ga0315907_1000386920 | 3300031758 | Freshwater | MCATCGCNYPNLDHAMANSKGDNPMGMPIAPMPSSIQTAVPKKPKK |
Ga0315907_100574556 | 3300031758 | Freshwater | MCATCGCNYPNLDHAMANAMGNNPMGMPIAPKPSSIVKATPKKPKK |
Ga0315907_101275073 | 3300031758 | Freshwater | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIQTATPKKPGK |
Ga0315907_102371554 | 3300031758 | Freshwater | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIVKATPKQPKK |
Ga0315907_102894281 | 3300031758 | Freshwater | VNNMCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSSIEKATPKKPGK |
Ga0315907_104267893 | 3300031758 | Freshwater | MCATCGCNYPNLDHAMANAMGNNPMGMPIAPKPSSIVKATPKKPKGK |
Ga0315907_106947723 | 3300031758 | Freshwater | MCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSSIEK |
Ga0315907_107419561 | 3300031758 | Freshwater | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIQTATPKKPKK |
Ga0315907_109023123 | 3300031758 | Freshwater | MCATCGCNYPNLEHSMANAMGNNPMGMPIAPKPSSIQKAEPKKPKGK |
Ga0315899_107668834 | 3300031784 | Freshwater | MCATCGCNYPNLDHAMANAMGDNPMGMPIAPKPSSIVKATPKKPKK |
Ga0315900_100112064 | 3300031787 | Freshwater | MCSTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSITKATPKKPKK |
Ga0315909_100895484 | 3300031857 | Freshwater | MCATCGCNYPNLDHSMANAMGNNPMGMPIAPKPSSIVKATPKKPKK |
Ga0315909_102659104 | 3300031857 | Freshwater | MCTTCGCNYPNLEHAMANAKGDNPMGMPIAPKPSSIVKAEPKKPKGK |
Ga0315909_103947355 | 3300031857 | Freshwater | MCATCGCNYPNLEHAMANAMGDNPMGMPIAPKPSSIVKATPKKPKGK |
Ga0315909_107995831 | 3300031857 | Freshwater | NMCATCGCNYPNLDHAMANAKGDNPMGMPIAPMPSSIETATPKKPKK |
Ga0315909_108608023 | 3300031857 | Freshwater | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPMPSSIETAVPKKPKK |
Ga0315909_109059871 | 3300031857 | Freshwater | MCATCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIVKATPKKPKK |
Ga0315909_109150362 | 3300031857 | Freshwater | MCATCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIVKATPKQPKK |
Ga0315904_1000639626 | 3300031951 | Freshwater | MCTTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIQKPAPKKPKK |
Ga0315904_100990336 | 3300031951 | Freshwater | ESQRKEEKIMCATCGCNYPNLDHAMANAMGNNPMGMPIAPKPSSIVKATPKKPKK |
Ga0315904_103945212 | 3300031951 | Freshwater | MLKNKQKEVKNNMCSTCGCNYPNIDHAMANAKGDNPMGMPIAPKPSSIEKATPKKPGK |
Ga0315906_106278833 | 3300032050 | Freshwater | MCATCGCNYPNLEHSMANAMGNNPMGMPIAPKPSSIVKATPKKPKGK |
Ga0315902_109965873 | 3300032093 | Freshwater | MCTTCGCNYPNVDHAMANSKGDNPMGMPIAPKPSSIQSATPKKPKK |
Ga0315902_111949413 | 3300032093 | Freshwater | MCTTCGCNYPNVDHAMANAMGDNPMGMPIAPKPSSIVKATPKKPKK |
Ga0315902_112739333 | 3300032093 | Freshwater | MCATCGCNYPNLDHAMANDMGDNPMGMPIAPKPSSIVKATPKKPK |
Ga0334994_0307432_360_500 | 3300033993 | Freshwater | MCSTCGCNYPNLDHAMANAKGDNPMGMPIAPKPSSIEKATPKKPGK |
Ga0334987_0135607_1202_1345 | 3300034061 | Freshwater | MCTTCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIQKAVPKKPKGK |
Ga0334987_0138033_447_587 | 3300034061 | Freshwater | MCTTCGCNYPNLEHAMANAKGNNPIGMPIAPVPSSIEKAVPKKPKK |
Ga0334995_0170099_708_851 | 3300034062 | Freshwater | MCATCGCNYPNLDHAMANAMGNNPMGMPIAPKPSSIETAVPKKPKGK |
Ga0335060_0583257_354_494 | 3300034122 | Freshwater | MCATCGCNYPNLEHAMANAKGNNPMGMPIAPKPSSIEKATPKKPKK |
Ga0335049_0023491_3_134 | 3300034272 | Freshwater | MCSTCGCNYPNVDHAMANAKGDNPMGMPIAPKPSSIEKATPKKP |
⦗Top⦘ |