NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068804

Metagenome / Metatranscriptome Family F068804

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068804
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 52 residues
Representative Sequence KIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Number of Associated Samples 104
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.84 %
% of genes near scaffold ends (potentially truncated) 93.55 %
% of genes from short scaffolds (< 2000 bps) 84.68 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.968 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(45.161 % of family members)
Environment Ontology (ENVO) Unclassified
(54.839 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(54.032 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.51%    β-sheet: 10.13%    Coil/Unstructured: 49.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF07730HisKA_3 42.74
PF02518HATPase_c 42.74
PF00990GGDEF 1.61
PF02563Poly_export 0.81
PF14361RsbRD_N 0.81
PF00196GerE 0.81
PF03150CCP_MauG 0.81
PF02310B12-binding 0.81
PF00210Ferritin 0.81
PF00571CBS 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 42.74
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 42.74
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 42.74
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 42.74
COG1596Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp foldCell wall/membrane/envelope biogenesis [M] 0.81
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.97 %
UnclassifiedrootN/A4.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10437099All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales534Open in IMG/M
3300005355|Ga0070671_101022823All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales724Open in IMG/M
3300005439|Ga0070711_100918864All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300005439|Ga0070711_101959416All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300005545|Ga0070695_101791139All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales515Open in IMG/M
3300005712|Ga0070764_10053509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2077Open in IMG/M
3300005993|Ga0080027_10068811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas koreensis1299Open in IMG/M
3300006050|Ga0075028_100804134All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales573Open in IMG/M
3300006574|Ga0074056_10835973All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales869Open in IMG/M
3300006804|Ga0079221_11800872All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium501Open in IMG/M
3300006854|Ga0075425_101037201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales935Open in IMG/M
3300009826|Ga0123355_11335549All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium715Open in IMG/M
3300010048|Ga0126373_12513119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium574Open in IMG/M
3300010376|Ga0126381_102466307All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium745Open in IMG/M
3300010376|Ga0126381_104609646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium531Open in IMG/M
3300010398|Ga0126383_11253641All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium831Open in IMG/M
3300012203|Ga0137399_10090484All Organisms → cellular organisms → Bacteria2345Open in IMG/M
3300012683|Ga0137398_10300716All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1078Open in IMG/M
3300012918|Ga0137396_10909719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium644Open in IMG/M
3300012927|Ga0137416_11122022All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium706Open in IMG/M
3300012929|Ga0137404_12110206All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300012971|Ga0126369_11583912All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium745Open in IMG/M
3300012971|Ga0126369_12832174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium568Open in IMG/M
3300012986|Ga0164304_11346422All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium584Open in IMG/M
3300015374|Ga0132255_103225987All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium695Open in IMG/M
3300016294|Ga0182041_10748788All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium870Open in IMG/M
3300016357|Ga0182032_10486889All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1012Open in IMG/M
3300016387|Ga0182040_11785119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300016422|Ga0182039_10936469All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium775Open in IMG/M
3300017955|Ga0187817_10820252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium594Open in IMG/M
3300018047|Ga0187859_10751261All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium557Open in IMG/M
3300018468|Ga0066662_10844126All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium894Open in IMG/M
3300021088|Ga0210404_10764603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium552Open in IMG/M
3300021420|Ga0210394_11228531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium642Open in IMG/M
3300021560|Ga0126371_13061494All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium566Open in IMG/M
3300025905|Ga0207685_10832369All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium510Open in IMG/M
3300026281|Ga0209863_10209872All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium563Open in IMG/M
3300026343|Ga0209159_1144203All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium950Open in IMG/M
3300026557|Ga0179587_10842800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium604Open in IMG/M
3300027669|Ga0208981_1198445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium503Open in IMG/M
3300027738|Ga0208989_10029875All Organisms → cellular organisms → Bacteria1884Open in IMG/M
3300028047|Ga0209526_10035968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3487Open in IMG/M
3300028047|Ga0209526_10953159All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium517Open in IMG/M
3300028877|Ga0302235_10484852All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium525Open in IMG/M
3300031057|Ga0170834_107640519All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium660Open in IMG/M
3300031236|Ga0302324_102565091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium620Open in IMG/M
3300031543|Ga0318516_10808564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium529Open in IMG/M
3300031544|Ga0318534_10188634All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1191Open in IMG/M
3300031546|Ga0318538_10764640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium524Open in IMG/M
3300031549|Ga0318571_10428031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium521Open in IMG/M
3300031564|Ga0318573_10261767All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium923Open in IMG/M
3300031572|Ga0318515_10059477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1941Open in IMG/M
3300031640|Ga0318555_10146289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1264Open in IMG/M
3300031640|Ga0318555_10370523All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium776Open in IMG/M
3300031668|Ga0318542_10458734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium661Open in IMG/M
3300031668|Ga0318542_10508530All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium626Open in IMG/M
3300031681|Ga0318572_10202102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1160Open in IMG/M
3300031681|Ga0318572_10340238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium889Open in IMG/M
3300031713|Ga0318496_10242299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium993Open in IMG/M
3300031719|Ga0306917_10753441All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium764Open in IMG/M
3300031723|Ga0318493_10104595All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1425Open in IMG/M
3300031724|Ga0318500_10046372All Organisms → cellular organisms → Bacteria → Proteobacteria1826Open in IMG/M
3300031747|Ga0318502_10132518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1409Open in IMG/M
3300031751|Ga0318494_10112067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1513Open in IMG/M
3300031753|Ga0307477_10129940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1758Open in IMG/M
3300031769|Ga0318526_10340309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium613Open in IMG/M
3300031771|Ga0318546_10006524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5887Open in IMG/M
3300031771|Ga0318546_10159800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1523Open in IMG/M
3300031777|Ga0318543_10063932All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1528Open in IMG/M
3300031782|Ga0318552_10042043All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2142Open in IMG/M
3300031795|Ga0318557_10547974All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium531Open in IMG/M
3300031796|Ga0318576_10107228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1279Open in IMG/M
3300031797|Ga0318550_10010299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3582Open in IMG/M
3300031798|Ga0318523_10145639All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1177Open in IMG/M
3300031799|Ga0318565_10263982All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium837Open in IMG/M
3300031805|Ga0318497_10093454All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1606Open in IMG/M
3300031805|Ga0318497_10598401All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium618Open in IMG/M
3300031823|Ga0307478_10804399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium787Open in IMG/M
3300031845|Ga0318511_10561823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium530Open in IMG/M
3300031859|Ga0318527_10139582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1012Open in IMG/M
3300031879|Ga0306919_10018375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4165Open in IMG/M
3300031890|Ga0306925_10068035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3743Open in IMG/M
3300031890|Ga0306925_11062216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium821Open in IMG/M
3300031890|Ga0306925_11429609All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium681Open in IMG/M
3300031894|Ga0318522_10189773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium777Open in IMG/M
3300031896|Ga0318551_10082129All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1689Open in IMG/M
3300031896|Ga0318551_10422631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium759Open in IMG/M
3300031897|Ga0318520_10154653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1332Open in IMG/M
3300031912|Ga0306921_10432927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1534Open in IMG/M
3300031945|Ga0310913_10195473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1411Open in IMG/M
3300031946|Ga0310910_11117408All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium613Open in IMG/M
3300031947|Ga0310909_10008954All Organisms → cellular organisms → Bacteria6725Open in IMG/M
3300031959|Ga0318530_10458923All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium529Open in IMG/M
3300031981|Ga0318531_10459080All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium577Open in IMG/M
3300032001|Ga0306922_10237891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1956Open in IMG/M
3300032008|Ga0318562_10387359All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium813Open in IMG/M
3300032039|Ga0318559_10051346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1727Open in IMG/M
3300032043|Ga0318556_10087547All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1563Open in IMG/M
3300032052|Ga0318506_10390008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium617Open in IMG/M
3300032055|Ga0318575_10261051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium874Open in IMG/M
3300032059|Ga0318533_11347424All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium521Open in IMG/M
3300032063|Ga0318504_10410002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium646Open in IMG/M
3300032066|Ga0318514_10047754All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2062Open in IMG/M
3300032066|Ga0318514_10609589All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium581Open in IMG/M
3300032067|Ga0318524_10007167All Organisms → cellular organisms → Bacteria → Proteobacteria4549Open in IMG/M
3300032068|Ga0318553_10085673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1592Open in IMG/M
3300032076|Ga0306924_10119955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2991Open in IMG/M
3300032076|Ga0306924_10187641All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2373Open in IMG/M
3300032174|Ga0307470_10072703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1863Open in IMG/M
3300032174|Ga0307470_10322008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1059Open in IMG/M
3300032174|Ga0307470_11372349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium582Open in IMG/M
3300032261|Ga0306920_103244143All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium608Open in IMG/M
3300032805|Ga0335078_10049886All Organisms → cellular organisms → Bacteria6191Open in IMG/M
3300032892|Ga0335081_11391910All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium784Open in IMG/M
3300032893|Ga0335069_12358579All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300033134|Ga0335073_11357478All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium698Open in IMG/M
3300033158|Ga0335077_11389445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium677Open in IMG/M
3300033289|Ga0310914_10663899All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium937Open in IMG/M
3300033289|Ga0310914_11265288All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium640Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil45.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.61%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1039907023300001867Forest SoilLALSTRPRPKIIVLTNFGLPEYRREAELFGVEAFLDKAREYFRLPSLLTGFAKEHAVQGVPKKPH*
JGI12627J18819_1043709923300001867Forest SoilLTNFGLPEYRREAELFGVEAFLDKAREYFRLPSLLTDFAKQRPVQDPH*
Ga0070671_10102282323300005355Switchgrass RhizosphereKIVILTNFGLPEYRREAEAFGVEAFLDKARDYFRLPSLLTDFARDRTERPH*
Ga0070711_10091886433300005439Corn, Switchgrass And Miscanthus RhizosphereLALSTRPRPKIIVLTNFGLPEYRREAELFGVDAFLDKSREYFRLPSVLTGFAKELAAQDHLV*
Ga0070711_10195941623300005439Corn, Switchgrass And Miscanthus RhizosphereTRPRPKIIVMTNFALPEYRREAELFGVEAFLDKAGEYFRLPSLLTGFAKEHAGQDRH*
Ga0070695_10179113923300005545Corn, Switchgrass And Miscanthus RhizosphereLQRPKIIILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPGLLRDFAKELGTAAAPL*
Ga0070764_1005350943300005712SoilSSSRPKVIILTNFGLPEYRREAETFGVEAFLDKSRDYFRLPGLLQDFARERAGNEAS*
Ga0070764_1070266213300005712SoilLARGTRHRPKIIILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTGFAQERNTTLNHH*
Ga0080027_1006881123300005993Prmafrost SoilTRRPKIVILTNFGLPEYRREAENFGVEAFLDKSRDYFRLPALLRDFAKDRGGEPDANAH*
Ga0075028_10080413413300006050WatershedsRQARRPKIVILTNFGLPEYRREAENFGVEAFLDKSRDYFRLPALLRDFAKDRSEPEPH*
Ga0074056_1083597313300006574SoilIILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPGLLRDFAKELGTAAPL*
Ga0079221_1180087213300006804Agricultural SoilYRREAEAFGVEAFLDKSRDYFRLPSLLSDFARDRIEQPH*
Ga0075425_10103720133300006854Populus RhizosphereRPKIIVLTNFGLSEYRREAELFGVEAFLDKAREYFRLPSLLTDFAKQHAVQDPH*
Ga0123355_1133554913300009826Termite GutNFGLPEYRREAETFGVEAFLDKSRDYFRLPSLLIGFARERAAPGVN*
Ga0126373_1251311913300010048Tropical Forest SoilRALARSRLRANGGRPKIVSLTNFGRPEYRKEAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDGRTAH*
Ga0126381_10246630713300010376Tropical Forest SoilTNFGLPEYRREAETFGVEAFLDKSRDYFRLPSLLTGFAKDRSAPQTH*
Ga0126381_10460964613300010376Tropical Forest SoilLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTYFARDRAEARH*
Ga0126383_1125364113300010398Tropical Forest SoilEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRADARH*
Ga0137399_1009048443300012203Vadose Zone SoilRSLARGGHRPKVVILTNFGLPEYRHEAESLGVEAFLDKSRDYFRLPSLLRGFAKERTIGDA*
Ga0137398_1030071623300012683Vadose Zone SoilVILTNFGLPEYRREAESYGVEAFLDKSRDYFRLPTLLSGFARDRALGAAE*
Ga0137396_1090971923300012918Vadose Zone SoilGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFARERAGGGP*
Ga0137416_1112202213300012927Vadose Zone SoilRPKVVILTNFGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFARERAAADH*
Ga0137404_1211020613300012929Vadose Zone SoilLPEYRHEAESLGVEAFLDKSRDYFRLPSLLRGFAKERTIGDA*
Ga0126369_1158391223300012971Tropical Forest SoilLARLRAAGARPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRVDARH*
Ga0126369_1283217413300012971Tropical Forest SoilLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRADARH*
Ga0164304_1134642213300012986SoilLAEYRREAEALGVEAFLDKSRDYFRLPSLLSGFAKQRDGERAN*
Ga0132255_10322598723300015374Arabidopsis RhizosphereLTNFGLPEYRREAESFGVEAFLDKSRDYFRLPGLLRDFAKELGTAAAPL*
Ga0182041_1074878823300016294SoilILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0182032_1048688913300016357SoilRRRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0182040_1178511923300016387SoilLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDRPH
Ga0182039_1093646923300016422SoilLRALARAKKGRGPRPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDPPH
Ga0187817_1082025213300017955Freshwater SedimentPKIVILTNFGLPEYRKEAEALGVEAFLDKSRDYFRLPSLLTDFARDRGAAAPH
Ga0187859_1075126123300018047PeatlandSRRPKIIILSNFGLAEYRREAEHYGVDFFLDKSREYFRLPSLLSDFARERDATRTH
Ga0066655_1034070413300018431Grasslands SoilTPRRRTTRPRVDIHRPKVVVLTNFGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFARERAAGDA
Ga0066662_1084412633300018468Grasslands SoilPRGGHRPKVVVLTNFGLPEYRHEAESFGAEAFLDKSRDYFRLPSLLRGFARERAAGDH
Ga0210404_1076460313300021088SoilILTNFGLPEYRHEAESLGVEAFLDKSRDYFRLPSLLRGFAKERAVGGA
Ga0210394_1122853113300021420SoilSSARDKASQRPKVIILTNFGLPEYRREAETFGVEAFLDKSRDYFRLPALLRDFANQRSVGGPAPA
Ga0126371_1306149413300021560Tropical Forest SoilYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0207685_1083236923300025905Corn, Switchgrass And Miscanthus RhizosphereLPEYRREAEAFGVEAFLDKARDYFRLPSLLTDFARDRTERPH
Ga0209863_1020987223300026281Prmafrost SoilRHTRRPKIVILTNFGLPEYRREAENFGVEAFLDKSRDYFRLPALLRDFAKDRGGEPDANA
Ga0209159_114420313300026343SoilARAGHRPKVVVLTNFGLPEYRHEAESLGVEAFLDKSRDYFRLPSLLRGFARERAAGDS
Ga0179587_1084280023300026557Vadose Zone SoilFGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFAREHAAGDN
Ga0208981_119844523300027669Forest SoilRSLARGGHRPKVVILTNFGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFARERDTGD
Ga0208989_1002987533300027738Forest SoilILTNFGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFARERDTGDP
Ga0209526_1003596853300028047Forest SoilKVVILTNFGLPEYRHEAESFGVEAFLDKSRDYFRLPSLLRGFAKERATGDS
Ga0209526_1095315913300028047Forest SoilRVNPILTNFGLPEYRREAESFGVETFLDKSRDYFRLPALLHDFAKERMS
Ga0302235_1048485213300028877PalsaNFGLPEYRREAETFGVEAFLDKSRDYFRLPALLQDFAKERSESEAS
Ga0170834_10764051913300031057Forest SoilPPPKVVILTNFGLPEYRRESESFGVEAFLDKSRDYFQIPALLQGFAKERLDPGTR
Ga0302324_10256509113300031236PalsaGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTGFAQERNDAGSH
Ga0318516_1080856423300031543SoilLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDEARHH
Ga0318534_1018863423300031544SoilFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0318538_1076464023300031546SoilIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318571_1042803113300031549SoilLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTEAHH
Ga0318573_1026176733300031564SoilTARGRRPKIVILTNFGLPEYRREAEAFGVDAFLDKSRDYFRLPSLLTDFARDRAEHGPH
Ga0318515_1005947713300031572SoilVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318555_1014628913300031640SoilLSRPRASARRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDEARHH
Ga0318555_1037052323300031640SoilRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318542_1045873413300031668SoilNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDEARHH
Ga0318542_1050853013300031668SoilFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0318572_1020210223300031681SoilRALSRSGSPARTRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318572_1034023823300031681SoilVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0318496_1024229913300031713SoilGLPEYRREAEAFGVDAFLDKSRDYFRLPSLLTDFARDRAEHGPH
Ga0310813_1002529373300031716SoilRSLALRTRPRPKIIVLTNFGLAEYRREAELFGVEAFLDKSREYFRLPSLLTGFAKEHAVQDPH
Ga0306917_1075344113300031719SoilRPRAAAARRPKIVVLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLSDFARDRADAR
Ga0318493_1010459523300031723SoilNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQEPH
Ga0318500_1004637213300031724SoilGRRPKIVILTNFGLPEYRREAEAFGVDAFLDKSRDYFRLPSLLTDFARDRAEHGPH
Ga0318502_1013251813300031747SoilFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0318494_1011206713300031751SoilVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0307477_1012994013300031753Hardwood Forest SoilVIILTNFGLPEYRREAESLGAEAFLDKSRDYFRLPSLLTGFARTHTPRGATH
Ga0318526_1034030923300031769SoilPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0318546_1000652413300031771SoilVLRALARSRAGRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0318546_1015980023300031771SoilEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTEAHH
Ga0318543_1006393213300031777SoilPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318552_1004204333300031782SoilPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0318557_1054797423300031795SoilVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDEARHH
Ga0318576_1010722823300031796SoilGRGPRPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0318550_1001029943300031797SoilIVVLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTEAHH
Ga0318523_1014563913300031798SoilKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318565_1026398213300031799SoilALSRPRASARRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDEARHH
Ga0318497_1009345423300031805SoilILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0318497_1059840113300031805SoilIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0307478_1080439913300031823Hardwood Forest SoilEYRREAESFGVEAFLDKSRDYYRLPSLLGGFARDQIAARRH
Ga0318511_1056182323300031845SoilSRAGSPARRRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318527_1013958223300031859SoilPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0306919_1001837543300031879SoilSGSPARRRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQP
Ga0306925_1006803543300031890SoilRAKKGRGPRPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQP
Ga0306925_1106221623300031890SoilASARRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRASQAHH
Ga0306925_1142960923300031890SoilVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLSDFARDRAEHGPH
Ga0318522_1018977313300031894SoilLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEAHH
Ga0318551_1008212923300031896SoilTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0318551_1042263123300031896SoilVARARAAGRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0318520_1015465323300031897SoilKGRGPRPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDPPH
Ga0306921_1043292723300031912SoilILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0310913_1019547323300031945SoilRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0310910_1111740823300031946SoilGRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0310909_1000895413300031947SoilVLRALSRAGSPARRRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0310909_1079424523300031947SoilEYRREAESFGIEAFLDKSRDYFRLPSLLTGFARERSAPPAQ
Ga0318530_1045892313300031959SoilEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318531_1045908013300031981SoilNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0306922_1023789133300032001SoilKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEARH
Ga0318562_1038735913300032008SoilNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAQTH
Ga0318559_1005134623300032039SoilARARAAGRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEAR
Ga0318556_1008754723300032043SoilPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTQQPH
Ga0318506_1039000813300032052SoilTNFGLPEYRREAEAFGVDAFLDKSRDYFRLPSLLTDFARDRAEHGPH
Ga0318575_1026105113300032055SoilEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTEARH
Ga0318533_1134742413300032059SoilKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRDEARH
Ga0318504_1041000223300032063SoilRGPRPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0318514_1004775433300032066SoilRPRAAAGRRPKIVVLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEAH
Ga0318514_1060958913300032066SoilGRQRPKIIILTNFGLPEYRREAETFGVEAFLDKSRDYFRLPSLLTGFARDRAAQPPH
Ga0318524_1000716743300032067SoilLRALSRPRAAAARRPKIVVLTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTEAHH
Ga0318553_1008567323300032068SoilPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRTEAHH
Ga0306924_1011995543300032076SoilALARSRAGRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPRH
Ga0306924_1018764113300032076SoilTARGRRPKIVIQTNFGLPEYRREAEAFGVDAFLDKSRDYFRLPSLLTDFARDRAEHGPH
Ga0307470_1007270333300032174Hardwood Forest SoilPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTARPH
Ga0307470_1032200823300032174Hardwood Forest SoilKRGPTGQKPKVIILTNFGLPEYRREAESLGVEAFLDKSRDYFRLPALLRDFAFAKERASA
Ga0307470_1137234913300032174Hardwood Forest SoilTNFGLPEYRREAELFGVEAFLDKAREYFRLPSLLTGFAKEHAVQNPH
Ga0306920_10324414313300032261SoilARLRAAGRRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRAEPR
Ga0335078_1004988613300032805SoilLPEYRREAELFGVEAFLDKAREYIRLPSLLTDFAKEHAVQNRH
Ga0335081_1139191013300032892SoilILTNFGLPEYRREAELLGAEAFLDKSRDYFRLPALLSGFARERTEERPH
Ga0335069_1235857913300032893SoilPKIIVLTNFGLPEYRREAESFGVEAFLDKAREYFRLPSLLTGFAREHAVQAPH
Ga0335073_1135747823300033134SoilPRPKVVILTNYGLPEYRREAESYGVEAFLDKSRDYFQLPGLLRQFARDHSAGETGS
Ga0335077_1138944523300033158SoilPKVIILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPALLRDFADGRPVSDAI
Ga0310914_1066389913300033289SoilRALARAKKGRGPRPKIVILTNFGLPEYRREAESFGVEAFLDKSRDYFRLPSLLTDFARDRTDQPH
Ga0310914_1126528823300033289SoilGSRASARRPKIVILTNFGLPEYRREAEAFGVEAFLDKSRDYFRLPSLLTDFARDRASQAH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.