NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068883

Metagenome Family F068883

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068883
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 44 residues
Representative Sequence ETFYNLAIAYSESGNPSMAATQARILQKLDPKLYEKYLRETM
Number of Associated Samples 100
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 89.52 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.387 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(12.097 % of family members)
Environment Ontology (ENVO) Unclassified
(54.839 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(72.581 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.86%    β-sheet: 0.00%    Coil/Unstructured: 47.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF05193Peptidase_M16_C 56.45
PF13414TPR_11 2.42
PF13431TPR_17 1.61
PF07690MFS_1 0.81
PF13458Peripla_BP_6 0.81
PF00069Pkinase 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.23

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.39 %
UnclassifiedrootN/A1.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10050742All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium1854Open in IMG/M
3300004480|Ga0062592_100583669All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300004480|Ga0062592_100985282All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300004643|Ga0062591_101263096All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300005290|Ga0065712_10705703All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005295|Ga0065707_10022466All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium2125Open in IMG/M
3300005331|Ga0070670_100424286All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005334|Ga0068869_101772922All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005336|Ga0070680_100381354All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300005343|Ga0070687_100625858All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300005353|Ga0070669_101206119All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005356|Ga0070674_101007593All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005364|Ga0070673_101312661All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005444|Ga0070694_100379563All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300005456|Ga0070678_102226359All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005459|Ga0068867_100161637All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium1766Open in IMG/M
3300005459|Ga0068867_100759289All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300005539|Ga0068853_100013547All Organisms → cellular organisms → Bacteria → Acidobacteria6663Open in IMG/M
3300005539|Ga0068853_101222143All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300005545|Ga0070695_101056890All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300005546|Ga0070696_100199278All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300005549|Ga0070704_100354837All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300005577|Ga0068857_101701156All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005578|Ga0068854_100036546All Organisms → cellular organisms → Bacteria3444Open in IMG/M
3300005617|Ga0068859_102175946All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005618|Ga0068864_100089181All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium2717Open in IMG/M
3300005618|Ga0068864_101599142All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005618|Ga0068864_101619120All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005718|Ga0068866_10690850All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005719|Ga0068861_102689136All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005841|Ga0068863_100346761All Organisms → cellular organisms → Bacteria1445Open in IMG/M
3300005842|Ga0068858_100553348All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300005842|Ga0068858_101058926All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005843|Ga0068860_101888446All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006358|Ga0068871_101329093All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006845|Ga0075421_100175938All Organisms → cellular organisms → Bacteria → Acidobacteria2663Open in IMG/M
3300006852|Ga0075433_10182763All Organisms → cellular organisms → Bacteria1866Open in IMG/M
3300006880|Ga0075429_100334418All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300006880|Ga0075429_100630621All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300006880|Ga0075429_100690933All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300006904|Ga0075424_102838676All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006954|Ga0079219_10507035All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300009011|Ga0105251_10235076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J367825Open in IMG/M
3300009101|Ga0105247_11843718All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300009147|Ga0114129_11255793All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300009174|Ga0105241_12210452All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300009176|Ga0105242_12943316All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300009545|Ga0105237_10038678All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum4817Open in IMG/M
3300009545|Ga0105237_11324082All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300009553|Ga0105249_13474417All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300009789|Ga0126307_11785778All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300010038|Ga0126315_10518658All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300010040|Ga0126308_10842471All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300010040|Ga0126308_11162347Not Available545Open in IMG/M
3300010046|Ga0126384_11729679All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300010359|Ga0126376_10238367All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300010373|Ga0134128_11538002All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010373|Ga0134128_12283674All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010397|Ga0134124_10647969All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300010399|Ga0134127_13499825All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010400|Ga0134122_10408219All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300012922|Ga0137394_10484037All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300012948|Ga0126375_11930115All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012986|Ga0164304_11436141All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012987|Ga0164307_11226622All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300013100|Ga0157373_10950118All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300013306|Ga0163162_11035493All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300013307|Ga0157372_10547927All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300013308|Ga0157375_11839950All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300014325|Ga0163163_12974210All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014487|Ga0182000_10040596All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300014497|Ga0182008_10971929All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300015262|Ga0182007_10365419All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300015371|Ga0132258_10449787All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum3211Open in IMG/M
3300015373|Ga0132257_100285034All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum1981Open in IMG/M
3300015374|Ga0132255_102501919All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300018469|Ga0190270_10649499All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300018476|Ga0190274_10536866All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300021445|Ga0182009_10015093All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum2793Open in IMG/M
3300021445|Ga0182009_10291328All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300025885|Ga0207653_10382052All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
3300025908|Ga0207643_10505198All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300025911|Ga0207654_10534694All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300025911|Ga0207654_10685989All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300025913|Ga0207695_10331987All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Candidatus Paraburkholderia kirkii1409Open in IMG/M
3300025913|Ga0207695_10440868All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300025914|Ga0207671_10042477All Organisms → cellular organisms → Bacteria3365Open in IMG/M
3300025918|Ga0207662_11132561All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025918|Ga0207662_11254811All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300025925|Ga0207650_10673136All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300025930|Ga0207701_11233037All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300025931|Ga0207644_10030043All Organisms → cellular organisms → Bacteria3774Open in IMG/M
3300025933|Ga0207706_11100922All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300025942|Ga0207689_11067076All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025960|Ga0207651_11423059All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025961|Ga0207712_11401765All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025972|Ga0207668_11677523Not Available574Open in IMG/M
3300026035|Ga0207703_10814344All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300026035|Ga0207703_11502505All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300026041|Ga0207639_10125333All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum2117Open in IMG/M
3300026041|Ga0207639_12090564All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300026075|Ga0207708_10708233All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300026088|Ga0207641_10103610All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum2510Open in IMG/M
3300026088|Ga0207641_10341119All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300027873|Ga0209814_10265953All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300027873|Ga0209814_10363558All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300027909|Ga0209382_11900553All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300027909|Ga0209382_12220742All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028381|Ga0268264_11737956All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300028381|Ga0268264_11883718All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031547|Ga0310887_10743717All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031731|Ga0307405_10207955All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300031731|Ga0307405_10513784All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300031740|Ga0307468_100192359All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300031740|Ga0307468_102087521All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031901|Ga0307406_10655365All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031911|Ga0307412_10402296All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300031940|Ga0310901_10064998All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300032002|Ga0307416_101519207All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300032126|Ga0307415_102219304All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300032211|Ga0310896_10479682All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300032421|Ga0310812_10014255All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum2703Open in IMG/M
3300033412|Ga0310810_10833546All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300033412|Ga0310810_10849529All Organisms → cellular organisms → Bacteria813Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere12.10%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.03%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.42%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1005074233300000953SoilIDSYTEAARLRPDWAETFYNLAIAYSESGNPSMAASQARILQKLDQKLYEKYLRETM*
Ga0062592_10058366913300004480SoilSYTAAKELQPDNAETFYNLAIAYNEAGNPAMAAMEARTLQRLDRKLYEKYLRETM*
Ga0062592_10098528223300004480SoilEPDYAEGYYNLAVTYYETGNRTMAATEARILQKLDAKLYAKYLSETP*
Ga0062591_10126309623300004643SoilIDSYEAAKDLQPDNAETFYNLAIAYNEAGNPTMAAVEARILQRLDPKLYEKYLRETM*
Ga0065712_1070570313300005290Miscanthus RhizosphereCAEIFYNLAIAYFESGNLNKAAEEARILQRLDHKMYERYLRETM*
Ga0065707_1002246613300005295Switchgrass RhizosphereRPEWAEAFYSLAIAYSESGNPSMAATQARILQRLDPKLYEKYLRETM*
Ga0070670_10042428613300005331Switchgrass RhizosphereETFYNLAIAYSESGNPSMAATQARILQKLDPKLYEKYLRETM*
Ga0068869_10177292213300005334Miscanthus RhizosphereQPDVAETFYNLAIAYTESGNPSMAATQARILQRLDPKLYEKYLRETM*
Ga0070680_10038135423300005336Corn RhizosphereAETFYNLAVAYLESGNPSMAATEAKVLQRLDQKLYERYLRETM*
Ga0070687_10062585813300005343Switchgrass RhizosphereEYTEAARLRPECAEFFYNLAIAYFESGNLTMAASEARVLQKLDPKLYERYLRETM*
Ga0070669_10120611913300005353Switchgrass RhizosphereDWAETFYNLAIAYSESGNPSMAAQQARILQRLDQKLYEKYLRETM*
Ga0070674_10100759313300005356Miscanthus RhizosphereSYTDAARLDPECAETHYNLALAYFESGNQAMAATEARILQRLDKKLYEKYLRETM*
Ga0070673_10131266113300005364Switchgrass RhizosphereARLRPDWAETFYNLAVAYSESGNPGMAATEARILQRLDPKLYEKYMRETM*
Ga0070694_10037956323300005444Corn, Switchgrass And Miscanthus RhizosphereYNLAIAYSESGNPSMAATEARTLQKLDAKLYEKYLRETM*
Ga0070678_10222635923300005456Miscanthus RhizosphereRPDWAETFYNLAVAYSESGNPGMAAQEARILQRLDPKLYEKYLRETM*
Ga0068867_10016163713300005459Miscanthus RhizosphereDWAETFYNLAIAYSESGNPGMAATQARILQRLDPKLYEKYLRETM*
Ga0068867_10075928923300005459Miscanthus RhizospherePDDSETYYNLAIAYFESGNQAMAATQARTLQRLDKKLYERYVSETR*
Ga0068853_10001354713300005539Corn RhizospherePDCAETFYNLAVAYLESGNPSMAATEAKTLQRLDQKLYERYLRETM*
Ga0068853_10122214323300005539Corn RhizosphereLRPDWAETFYNLAIAYSESGNPSMAATEARILQRLDPKLYEKYLRETM*
Ga0070695_10105689013300005545Corn, Switchgrass And Miscanthus RhizosphereRLRPDWAETFYNLAIAYSESGNPSMAAQQARILQRLDQKLYEKYLRETM*
Ga0070696_10019927823300005546Corn, Switchgrass And Miscanthus RhizosphereTFYNLAIAYFESGNQSMAAAEARTLQRLDPKLYEKYVRETM*
Ga0070704_10035483723300005549Corn, Switchgrass And Miscanthus RhizosphereFYNLAIAYFESGNQTMAATEARTLQRLDPKLYEKYLRETM*
Ga0068857_10170115623300005577Corn RhizosphereEAARLRPDWAETFYNLAIAYSESGNPSMAATQARILQKLDPKLYEKYLRETM*
Ga0068854_10003654643300005578Corn RhizosphereCAETHYNLALAYFESGNQAMAATEARILQRLDKKLYEKYLRETM*
Ga0068859_10217594613300005617Switchgrass RhizosphereNLAIAYSESGNPSMAATEAHILQRLDRKLYEKYLRETM*
Ga0068864_10008918133300005618Switchgrass RhizosphereAEFFYNLAIAYFESGNLTMAASEARTLQRLDQKLYERYLRETM*
Ga0068864_10159914213300005618Switchgrass RhizospherePDWAETFYNLAVAYSESGNPGMAAQQARILQKLDAKLYEKYLRETM*
Ga0068864_10161912023300005618Switchgrass RhizosphereEAARLRPDWAETFYNLAIAYSESGNPSMAAQQARILQRLDQKLYEKYLRETM*
Ga0068866_1069085023300005718Miscanthus RhizosphereIAFSESGNPGMAAANARILQKLDAKLYEKYLRETM*
Ga0068861_10268913613300005719Switchgrass RhizosphereIAYSESGNPSMAATQARILQRLDPKLYEKYLRETM*
Ga0068863_10034676123300005841Switchgrass RhizosphereYNLAIAYSESGNPGMAATQARILQRLDPKLYEKYLRETM*
Ga0068858_10055334823300005842Switchgrass RhizospherePDWAETFYNLAIAYSESGNPSMAATQAQKLQKLDPKLYEKYLRETM*
Ga0068858_10105892623300005842Switchgrass RhizosphereWAETFYNLAVAYSESGNPGMAAQQARILQKLDPKLYEKYLRETM*
Ga0068860_10188844613300005843Switchgrass RhizosphereWAETFYNLAIAYAESGNPSMAAIQARILQRLDPKLYEKYLRETM*
Ga0068871_10132909323300006358Miscanthus RhizosphereAYSESGNPSMAATQARILQKLDPKLYEKYLRETM*
Ga0075421_10017593833300006845Populus RhizosphereETFYNLAIAYFESGNLAMAAAEARTLQRLDQKLYEKYLRETM*
Ga0075433_1018276313300006852Populus RhizosphereNAEAFYNLAIAYFESGNQTMAAAEARTLQRLDPKLYEKYLRETM*
Ga0075429_10033441823300006880Populus RhizospherePDNAETFYNLAIAYFESGNLAMAAAEARILQRLDQKLYEKYLRETM*
Ga0075429_10063062113300006880Populus RhizosphereLAIAYFESGNLTAASTQAKTLQRLDPKLYERYLRETM*
Ga0075429_10069093313300006880Populus RhizosphereATTYYEIGNRTMAGEEARKLQKLDAKLYEKYLSEIP*
Ga0075424_10283867613300006904Populus RhizosphereAIAYSESGNPSMAAAQARILQRLDPKLYEKYLRETM*
Ga0079219_1050703513300006954Agricultural SoilLAVAYSESGNPGMAATQARILQRLDPKLYEKYLRETM*
Ga0105251_1023507623300009011Switchgrass RhizosphereYNLAIAYSESGNPSMAASQARILQRLDPKLYEKYLRETM*
Ga0105247_1184371813300009101Switchgrass RhizosphereFYNLAIAYSESGNPSMAATQAQKLQKLDPKLYEKYLRETM*
Ga0114129_1125579313300009147Populus RhizosphereNLAIAYYENGNRTMAANEAHKLQKLDAKLYEKYLSEIP*
Ga0105241_1221045223300009174Corn RhizosphereLAIAYSDSGNPGMAAANARILQKLDRKLYEKYLRETM*
Ga0105242_1294331623300009176Miscanthus RhizosphereEAARLRPECAEFFYNLAIAYFESGNLTMAASEARVLQKLDPKLYERYLRETM*
Ga0105237_1003867813300009545Corn RhizosphereLRPDCAETFYNLAIAYSESGNPSMAVIQAQKLQKLDPKLYDKYLHETM*
Ga0105237_1132408223300009545Corn RhizosphereDVAETFYNLAIAYTESGNPSMAATQARILQRLDPKLYEKYLRETM*
Ga0105249_1347441723300009553Switchgrass RhizosphereDAETYYNLALAYSEIGDKKNAAIQARTLQKLDSKLYEKYLSETN*
Ga0126307_1178577813300009789Serpentine SoilFYNLAIAYFESGNQSMAASQARVLQKLDPKLYERYMRETM*
Ga0126315_1051865823300010038Serpentine SoilDWAETFYNLAIAYSESGNPSMAASQARVLQRLDHKLYERYLRETM*
Ga0126308_1084247113300010040Serpentine SoilTFYNLAIAYSESGNPSMAAAEGRILQRLDSKLYEKYLRETM*
Ga0126308_1116234713300010040Serpentine SoilAYFESGNQAMATTQAKTLQRLDSKLYEKYVRESGVGSNP*
Ga0126384_1172967913300010046Tropical Forest SoilAYSESGNPGMAATEARILQKLDPKLYEKYMRETM*
Ga0126376_1023836713300010359Tropical Forest SoilTFYNLAIAYSESGNPGMAATQAQRLQKLDPKLYEKYLRETM*
Ga0134128_1153800223300010373Terrestrial SoilTFYNLAIGYAESGNPGMAATQAQKLQKLDPKLYEKYLRETM*
Ga0134128_1228367413300010373Terrestrial SoilTAAKQLRPDNAETFYNLAIAYYESGNLTMAAAEARSLQRLDHKLYEKYLRETM*
Ga0134124_1064796913300010397Terrestrial SoilEAARLRPDWAETFYNLAIAYSESGNPSMAAQQARILQRLDPKLYEKYLRETM*
Ga0134127_1349982523300010399Terrestrial SoilTFYNLAVAYSESGNPGMAAQQARILQKLDAKLYEKYLRETM*
Ga0134122_1040821933300010400Terrestrial SoilAIAYSESGNPGMAATQAQKLQKLDPKLYEKYLRETM*
Ga0137394_1048403713300012922Vadose Zone SoilCAETYYNLAIAYFESGNRSMAATQARALQRLDQKLYEKYLSETM*
Ga0126375_1193011513300012948Tropical Forest SoilNLATAYFESGNPSMAADEARVLDRLDHKLYERYLRERM*
Ga0164304_1143614123300012986SoilYNLAIAYSESGNPSMAATQARKLQQLDPKLYEKYLRETM*
Ga0164307_1122662223300012987SoilESYTDAARIDPDCAETHYNLALGYFESGNQTMAATEARILQRLDKKLYEKYLRETM*
Ga0157373_1095011813300013100Corn RhizosphereESARLRPDSAETFYNLAIAYFESGNLSMAAAEARVLQRLDQKLYERYLRETM*
Ga0163162_1103549313300013306Switchgrass RhizosphereTFYNLAIAYSESGNPSMAATQARILQRLDPKLYEKYLRETM*
Ga0157372_1054792723300013307Corn RhizosphereETYYNLAIAYSESGNQTMAATEARALQRLDPKLYEKYLRETM*
Ga0157375_1183995013300013308Miscanthus RhizosphereEVFYNLAIAYFESGNLSKAAEEARTLQRLDQKMYERYLRETM*
Ga0163163_1297421023300014325Switchgrass RhizosphereFYNLAIAYSESGNPSMAAAQARILQRLDPKLYEKYLRETM*
Ga0182000_1004059623300014487SoilETFYNLAIAYSDSGNPGMAAANARILQKLDGKLYEKYLRETM*
Ga0182008_1097192913300014497RhizosphereSEAAQLRPDCAETFYNLAIAYSESGNPSMAATEARKLKELDAKLYEKYLRETM*
Ga0182007_1036541913300015262RhizosphereLAIAYFESGNQTMAAAEARTLQRLDPKLYEKYLRETM*
Ga0132258_1044978713300015371Arabidopsis RhizosphereYTDAARINPECAETHYNLALAYFESGNQTMAATEARILQRLDKKLYEKYLRETM*
Ga0132257_10028503413300015373Arabidopsis RhizosphereYNLAVTYYETGNRTMAATEARILQKLDGKVYEKDLSETP*
Ga0132255_10250191923300015374Arabidopsis RhizosphereDWAEAYYNLAVAYQESGNQAMAETEARILQRLDGKLYEKYLRETL*
Ga0190270_1064949913300018469SoilNLAIAYFESGNQSMAAAEARTLKRLDPKLYERYLRETM
Ga0190274_1053686613300018476SoilPDLAETYYNLAVTYFESGNLNMAATQASALKDLDKKLYEKYVRETL
Ga0182009_1001509333300021445SoilAIAYSESGNPGMAATEAQKLQKLDQKLYEKYLRETM
Ga0182009_1029132823300021445SoilESIDSYTMAKQLEPNNAETFYNLAIAYFESGNQAMAATEARILQRLDRKLYEQYLRETM
Ga0207653_1038205213300025885Corn, Switchgrass And Miscanthus RhizosphereLRPDWAETFYNLAIAYAESGNQSMAATQARILQKLDQKLYE
Ga0207643_1050519823300025908Miscanthus RhizosphereVAETFYNLAIAYTESGNPSMAATQARILQRLDPKLYEKYLRETM
Ga0207654_1053469413300025911Corn RhizospherePDCAETFYNLAIAYSESGNPSMAAQQARTLQRLDPKLYEKYLRETM
Ga0207654_1068598913300025911Corn RhizosphereRPDWAETFYNLAVAYSERGNPGMAATEARILQRLDPKLYEKYMRETM
Ga0207695_1033198733300025913Corn RhizosphereAIAYSESGNPGMAATQAQKLQKLDPKLYEKYLRETM
Ga0207695_1044086823300025913Corn RhizosphereAIAYSESGNPSMAVIQAQKLQKLDPKLYDKYLHETM
Ga0207671_1004247743300025914Corn RhizosphereNLAIAYSESGNPSMAVIQAQKLQKLDPKLYDKYLHETM
Ga0207662_1113256113300025918Switchgrass RhizosphereCAEFFYNLAIAYFESGNLTMAASEARVLQKLDPKLYERYLRETM
Ga0207662_1125481123300025918Switchgrass RhizosphereITYSESGNPGMAATQARILQRLDQKLYEKYLRETM
Ga0207650_1067313623300025925Switchgrass RhizosphereLAIAYSESGNPSMAATQARILQKLDPKLYEKYLRETM
Ga0207701_1123303713300025930Corn, Switchgrass And Miscanthus RhizosphereYNLAIAYSESGNPSMAATQAQKLQKLDPKLYEKYLRETM
Ga0207644_1003004343300025931Switchgrass RhizosphereHYNLALAYFESGNQAMAATEARILQRLDKKLYEKYLRETM
Ga0207706_1110092213300025933Corn RhizosphereYNLALAYSEIGDKKNAAIQARTLQKLDSKLYEKYLSETN
Ga0207689_1106707623300025942Miscanthus RhizosphereDDREFKRLAIAYFESGNLTMAASEARSLQRLDQKLYERYLRETM
Ga0207651_1142305923300025960Switchgrass RhizosphereESYTEAAYLRPDWAETFYNLAIAYSESGNPSMAATQAQKLQKLDPKLYEKYLRETM
Ga0207712_1140176523300025961Switchgrass RhizosphereNLALAYSEIGDKKNAAIQARTLQKLDSKLYEKYLSETN
Ga0207668_1167752313300025972Switchgrass RhizosphereAEGYYNLAVTYYETGNRTMAAAEARILQKLDPKLYAKYLSETP
Ga0207703_1081434423300026035Switchgrass RhizosphereEAARLRPDWAETFYNLAIAYSESGNPSMAAQQARILQRLDPKLYEKYLRETM
Ga0207703_1150250523300026035Switchgrass RhizosphereNLAIAYAESGNQSMAATQARILQKLDQKLYEKYLRETM
Ga0207639_1012533313300026041Corn RhizosphereNAETFYNLAIAYAESGNPSMAAAQARILQKLDAKLYEKYLRETM
Ga0207639_1209056413300026041Corn RhizosphereTFYNLAIAYSESGNPSMAATEARILQKLDAKLYERYLRETM
Ga0207708_1070823323300026075Corn, Switchgrass And Miscanthus RhizospherePDWAETFYNLAIAYSESGNPSMAAQQARILQKLDPKLYEKYLRETM
Ga0207641_1010361013300026088Switchgrass RhizosphereRLRPDSAETFYNLAIAYSESGNPGMAATQARILQRLDPKLYEKYLRETM
Ga0207641_1034111923300026088Switchgrass RhizosphereDNAETFYNLAIAFSESGNPGMAAANARILQKLDGKLYEKYLRETM
Ga0209814_1026595323300027873Populus RhizosphereFYNLAIAYFESGNLSMAAAEARTLQRLDPKLYEKYVRETM
Ga0209814_1036355823300027873Populus RhizospherePECAEFFYNLAIAYFESGNLTAAATQARTLQRLDVKLYERYLRETM
Ga0209382_1190055323300027909Populus RhizosphereLRPDNAETFYNLAIAYFESGNLAMAAAEARTLQRLDQKLYEKYLRETM
Ga0209382_1222074213300027909Populus RhizosphereETFYNLAIAYFESGNLAMAAAEARTLQRLDQKLYEKYLRETM
Ga0268264_1173795613300028381Switchgrass RhizosphereNLAIAYSESGNPGMAATNARILQKLDGKLYEKYLRETM
Ga0268264_1188371823300028381Switchgrass RhizosphereNLAIAYAESGNPSMAATQARILQRLDPKLYEKYLRETM
Ga0310887_1074371713300031547SoilETFYNLAIAYSESGNPSMAAQQARILQRLDQKLYEKYLRETM
Ga0307405_1020795523300031731RhizosphereSYSEAAHLRPDWAETFYNLAIAYSESGNPSMAATQAQKLQKLDPKLYEKYLRETM
Ga0307405_1051378423300031731RhizosphereLAVAYTESGNPTMAAAEARTLQRLDPKLYEKYLRETM
Ga0307468_10019235923300031740Hardwood Forest SoilAVAYSESGNPGMAAQQARILQKLDPKLYEKYLRETM
Ga0307468_10208752123300031740Hardwood Forest SoilLAESHYNLAVAYFESGNLDMASSEARILQRLDKKLFEKYVRETMQG
Ga0307406_1065536513300031901RhizosphereIAYSESGNPGMAATHARILQRLDSKLYEKYLRETM
Ga0307412_1040229623300031911RhizosphereGFESYETARDLRPDNPETFYNLAIAYNEAGNPTMAAVEARILQRLAPKLYEKYLRETM
Ga0310901_1006499823300031940SoilEGYYNLAVTYYEAGNRTMAATEARILQKLDAKLYAKYLSETP
Ga0307416_10151920713300032002RhizosphereRAETFYNLAIAYSESGNPSMAATQARILQRLDHKLYEKYLRETM
Ga0307415_10221930413300032126RhizosphereFFYNLAIAYFESGNLTMAATQARRLEKLDPKLHERYLRETM
Ga0310896_1047968213300032211SoilIDEYTEAARLRPECAEFFYNLAIAYFESGNLTMAASEARVLQKLDPKLYERYLRETM
Ga0310812_1001425533300032421SoilFYNLAIAYSESGNPSMAATQAQKLQKLDPKLYDKYLRETM
Ga0310810_1083354613300033412SoilARLRPDWAETFYNLAIAYAESGNPSMAAQQARILQRLDPKLYEKYLRETM
Ga0310810_1084952913300033412SoilPDWAETFYNLAIAYSESGNPGMAATQAQKLQKLDPKLYEKYLRETM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.