NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068961

Metagenome / Metatranscriptome Family F068961

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068961
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 193 residues
Representative Sequence MSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Number of Associated Samples 107
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.42 %
% of genes near scaffold ends (potentially truncated) 77.42 %
% of genes from short scaffolds (< 2000 bps) 96.77 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(41.129 % of family members)
Environment Ontology (ENVO) Unclassified
(54.032 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.484 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 23.65%    β-sheet: 20.69%    Coil/Unstructured: 55.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF12697Abhydrolase_6 7.26
PF12796Ank_2 3.23
PF13637Ank_4 2.42
PF00023Ank 2.42
PF00953Glycos_transf_4 0.81
PF00213OSCP 0.81
PF00119ATP-synt_A 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 0.81
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.81
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459021|G14TP7Y01BM0KNAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300000953|JGI11615J12901_10447998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300001989|JGI24739J22299_10219268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300003693|Ga0032354_1075172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300004479|Ga0062595_100635741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300004479|Ga0062595_100832356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300004480|Ga0062592_100149275All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300004801|Ga0058860_12218973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300005329|Ga0070683_100181548All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300005336|Ga0070680_101872979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300005337|Ga0070682_100706374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium809Open in IMG/M
3300005340|Ga0070689_100878807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium792Open in IMG/M
3300005343|Ga0070687_100441742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300005365|Ga0070688_100144907All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300005441|Ga0070700_101015232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300005456|Ga0070678_100170323All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300005456|Ga0070678_101332083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300005459|Ga0068867_100329354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1268Open in IMG/M
3300005459|Ga0068867_100814537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300005544|Ga0070686_100642947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium840Open in IMG/M
3300005549|Ga0070704_101029681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300005578|Ga0068854_101559915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300005615|Ga0070702_101711536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300005616|Ga0068852_101083954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300005840|Ga0068870_10293787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1023Open in IMG/M
3300006237|Ga0097621_100475459All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300006881|Ga0068865_100170636All Organisms → cellular organisms → Bacteria1667Open in IMG/M
3300009094|Ga0111539_10699358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1180Open in IMG/M
3300009148|Ga0105243_10519088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1132Open in IMG/M
3300009156|Ga0111538_10801536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1193Open in IMG/M
3300009176|Ga0105242_10183343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1848Open in IMG/M
3300009176|Ga0105242_12328357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300009545|Ga0105237_10958247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300010036|Ga0126305_10011704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4425Open in IMG/M
3300010036|Ga0126305_10506605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300010037|Ga0126304_10848082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300010038|Ga0126315_10919054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300010041|Ga0126312_11209701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300010042|Ga0126314_10443143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium939Open in IMG/M
3300011119|Ga0105246_12241496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300011332|Ga0126317_10247298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300012892|Ga0157294_10029802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1131Open in IMG/M
3300012898|Ga0157293_10052737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300012907|Ga0157283_10012257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1463Open in IMG/M
3300012908|Ga0157286_10105458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300012911|Ga0157301_10032240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1245Open in IMG/M
3300012914|Ga0157297_10244633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300012985|Ga0164308_10900465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium779Open in IMG/M
3300014497|Ga0182008_10864091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300014969|Ga0157376_10233340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1710Open in IMG/M
3300015374|Ga0132255_101338546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1081Open in IMG/M
3300018027|Ga0184605_10096561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1302Open in IMG/M
3300019279|Ga0184642_1530951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300019362|Ga0173479_10244921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300020070|Ga0206356_11563737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300021951|Ga0222624_1621954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300022195|Ga0222625_1725041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300022756|Ga0222622_10472835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300022898|Ga0247745_1077481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300022901|Ga0247788_1098158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300023102|Ga0247754_1113072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300023266|Ga0247789_1004796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2029Open in IMG/M
3300024055|Ga0247794_10111500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300025901|Ga0207688_10052335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2288Open in IMG/M
3300025926|Ga0207659_10159351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1770Open in IMG/M
3300025934|Ga0207686_10875798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300025936|Ga0207670_10794038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300025961|Ga0207712_11649770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300025981|Ga0207640_11588075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300026075|Ga0207708_11065600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium704Open in IMG/M
3300026089|Ga0207648_11371661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300026095|Ga0207676_11193368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300026121|Ga0207683_10090955All Organisms → cellular organisms → Bacteria2718Open in IMG/M
3300026142|Ga0207698_10864859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300026861|Ga0207503_1011654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300028707|Ga0307291_1150316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300028708|Ga0307295_10018410All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300028721|Ga0307315_10201641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300028755|Ga0307316_10281465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300028771|Ga0307320_10054584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1478Open in IMG/M
3300028782|Ga0307306_10190668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300028787|Ga0307323_10167915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300028787|Ga0307323_10344603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300028791|Ga0307290_10089660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1120Open in IMG/M
3300028811|Ga0307292_10478424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300028828|Ga0307312_10102357All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300028876|Ga0307286_10108943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium977Open in IMG/M
3300028885|Ga0307304_10292451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300030829|Ga0308203_1071447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300030902|Ga0308202_1038517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium837Open in IMG/M
3300030902|Ga0308202_1044978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300030903|Ga0308206_1111290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300030903|Ga0308206_1167120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300030905|Ga0308200_1076078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300030905|Ga0308200_1112573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300030988|Ga0308183_1088530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300030988|Ga0308183_1140998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300030988|Ga0308183_1161616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300031058|Ga0308189_10304563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300031058|Ga0308189_10337642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300031082|Ga0308192_1056683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300031091|Ga0308201_10155318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300031091|Ga0308201_10228584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300031092|Ga0308204_10246827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300031092|Ga0308204_10323297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300031093|Ga0308197_10359392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300031093|Ga0308197_10374093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300031094|Ga0308199_1130528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300031096|Ga0308193_1069546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300031099|Ga0308181_1114963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300031114|Ga0308187_10292115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300031114|Ga0308187_10327410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300031123|Ga0308195_1057783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300031124|Ga0308151_1031004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300031421|Ga0308194_10266091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300031938|Ga0308175_101205163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300033412|Ga0310810_10553741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1123Open in IMG/M
3300034447|Ga0370544_15195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300034644|Ga0370548_083442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300034659|Ga0314780_181198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300034661|Ga0314782_110827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300034661|Ga0314782_209902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300034667|Ga0314792_154046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300034671|Ga0314796_176529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil41.13%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.03%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.03%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere2.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.61%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300003693Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026861Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031123Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031124Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034447Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4NP_016863202170459021Switchgrass, Maize And Mischanthus LitterVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN
JGI11615J12901_1044799813300000953SoilMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEDLDPEIRSTIKTFLATVVSGKDLGKSWNVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSSSQYYLDYASTQEILLEVGVSAPNAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN*
JGI24739J22299_1021926813300001989Corn RhizospherePGRGFGLLTIALLSRLILSKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKL
Ga0032354_107517213300003693Avena Fatua RhizosphereVFQTALSSARFNRFLLWGSGIVLFAGVVVLLLSLVKGNDQSTVGPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKNLDASWGVIAPSMRKGYTFKSWSHANELPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPTAKMRPTSFQLGLVPVLAGKDKRVWRVNYWMPRWT
Ga0062595_10063574113300004479SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVGPDKGFHPKLPAQSSPLQNSQGVTITKYEELDPEVRSTIKTFLATAVARKHLDASWGVIAPSLRKGYTFKSWSNGGKGQDGLPVIPYPIADVNSTDYFLDYASTKEILLEVGVSAPPKLKMRPTSFQLGLVPVSAGKTKKVWRVNYWMPRWTPP
Ga0062595_10083235613300004479SoilGRGFGLLTIALLSRLILSKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0062592_10014927523300004480SoilMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN*
Ga0058860_1221897313300004801Host-AssociatedFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLP
Ga0070683_10018154833300005329Corn RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0070680_10187297913300005336Corn RhizosphereLTNPLLSRLLPLKPMSVFQTALSSARFSRFLMWGSGVVLFVGVVVLLMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVTRKHLDASWGVIAPSMRKGYTFKSWSHAKALPVVPYPIEDVDSTDFFLDYASTKEILLEVGVSAPPA
Ga0070682_10070637413300005337Corn RhizosphereGQPGRGFGLLTIALLSRLILSKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0070689_10087880713300005340Switchgrass RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKK
Ga0070687_10044174213300005343Switchgrass RhizosphereLLTIALLSRLILSKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0070688_10014490713300005365Switchgrass RhizosphereVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0070700_10101523213300005441Corn, Switchgrass And Miscanthus RhizosphereLKPMSVFQTALSSARFSRFLMWGSGIVLFIGVVVLLMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPQVRSTIRTFLATAVTRKHLDTSWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDFFLDYASTKEILLEVGVSAPPAAKLRPTSFQLGLVPVLAGKDKKVWRVNYWMPRWTPPLPAN*
Ga0070678_10017032333300005456Miscanthus RhizosphereMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN*
Ga0070678_10133208313300005456Miscanthus RhizosphereKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIEDVNTTSYYLDYAATDEILLEVGVSAPEKQKLRPTTFQLGLSPVAVGKNKKVWRVDYWMPRWTPPLPTN*
Ga0068867_10032935413300005459Miscanthus RhizosphereMSVFQTALSSARFNRILMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIEDVNTTSYYLDYAATDEILLEVGVSAPEKQKLRPTTFQLGLSPVAVGKNKKKVWRVDYWMPRWTPPLPTN*
Ga0068867_10081453713300005459Miscanthus RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPL
Ga0070686_10064294713300005544Switchgrass RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYW
Ga0070704_10102968113300005549Corn, Switchgrass And Miscanthus RhizosphereARFSRFLMWGSGIVLFIGVVVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEVRSTIKTFLATVVSGKHLDKSWSVIAPSMRKGYTLKSWSNGGRAQGGLPVIPYPIEDVSSSKYYLDYASTQEILLEVGVSAPDKAKTRPASFQLGLVPVSAGAHKKVWRVDYWMPRWTPPLPTN*
Ga0068854_10155991513300005578Corn RhizosphereLKPMSVFQTALSSARFSRFLMWGSGIVLFIGVVVLLMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKHLDASWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPAAKMRPTSFQLGLVPVLAGKDKKVWRVNYWMPRWTPPL
Ga0070702_10171153613300005615Corn, Switchgrass And Miscanthus RhizosphereGVAVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPL
Ga0068852_10108395423300005616Corn RhizosphereKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0068870_1029378713300005840Miscanthus RhizosphereMSAFQTSLSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQ
Ga0097621_10047545923300006237Miscanthus RhizosphereMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN*
Ga0068865_10017063633300006881Miscanthus RhizosphereLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIEDVNTTSYYLDYAATDEILLEVGVSAPEKQKLRPTTFQLGLSPVAVGKNNKKVWRVDYWMPRWTPPLPTN*
Ga0111539_1069935813300009094Populus RhizosphereIPLLSRLHLSKPMSVFQTALSSARFNRFLMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLQNSQGVTITKFKQLDPEVRSTIKTFLSTAVKRRHLDKSWAVIGPAMRRGYTFKSWTHPGKEGLPVVPYPIADVDTTSYYLDYAATDEILLEVGVSAPQKEKMRPTTFQLGMSPVAVGKNKKVWRVDYWMPRWTPPLPTN*
Ga0105243_1051908833300009148Miscanthus RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDK
Ga0111538_1080153633300009156Populus RhizosphereMSVFQTALSSARFNRFLMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLQNSQGVTITKFKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRKGYTFKSWTHPGKEGLPVIPYPIADVNTTSYYLDYAATDEILLEVGVSAPQKEKLRPTTFQLGMSPVAVGKNKKVWRVDYWMPRWTPPLPTN*
Ga0105242_1018334343300009176Miscanthus RhizosphereMSVFQTALSSARFNRILMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIADVNTTSYYLDYAATDEILLEVGVSAPGKAKLRPTTFQLGLSPVAVGKNKKKVWRVDYWMPRWTPPLPTN*
Ga0105242_1232835713300009176Miscanthus RhizosphereVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0105237_1095824723300009545Corn RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATAVARKHLDASWGVIAPSLRKGYTFKSWSNGGKGQDGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKK
Ga0126305_1001170433300010036Serpentine SoilMSVFQTALSSARFNRFLMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLQNAQGVTITKYQELDPEVRSTIKTFLSTAVARRHLDKSWAVIGPTMRKGYTFKSWTHPSKEGLPVIPYPIADVNTTTYYLDYASTDEILLEVGVSAPAKRNMRPTSFQLGMSPVKVGPNKKVWRVDYWMPRWTPPLPTN*
Ga0126305_1050660523300010036Serpentine SoilMSVFQTALSSARFNRFLMWGSGVILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLQNSQGVTITKYKELDPEVRSTIKTFLSTAVARRHLDKSWGVIGPTMRRGYTFKSWTHPGKEGLPVIPYPIADVNTTTYYLDYASTDEILLEVGVSAPTKKNMRPTSFQLGMSPVAVGPNKKVWRVDYWMPRWTPPLPTN*
Ga0126304_1084808213300010037Serpentine SoilMSVFQTALSSARFNRFLMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLQNAQGVTITKYQELDPEVRSTIKTFLSTAVARRHLDKSWAVIGPTMRKGYTFKSWTHPSKEGLPVIPYPIADVNTTTYYLDYASTDEILLEVGVSAPAKRNMRPTSFQLGMSPVKVGPNKKVWRV
Ga0126315_1091905413300010038Serpentine SoilMSVFQTALSSARFNRFLMWGSAIILFAGVAVLVTSLVKGSDKTSVGPDKGFVPQLPAKSSPLQNAQGVTVTKYQQLDPEVRSTIRTFLATAVKREHLDQSWGVIAPSMRKGYTFQTWSHAKALPVIPYPIEDVDSTKYFLDYASTKEILLEVGVSAPAAEKLRPTAFQLGLVP
Ga0126312_1120970113300010041Serpentine SoilMSVFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKHLDASWGVIAPSMRKGYTFKSWSHATELPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPSAKMRPTSF
Ga0126314_1044314323300010042Serpentine SoilMSVFQTALSSARFNRFLMWGSGVILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLQNSQGVTITKYKELDPEVRSTIKTFLSTAVARRHLDKSWGVIGPTMRRGYTFKSWTHPGKEGLPVIPYPIADVNTTTYYLDYASTDEILLEVGVSAPAKRNMRPTSFQLGMSPVKVGPNKKVWRVDYWMPRWTPPLPTN*
Ga0105246_1224149613300011119Miscanthus RhizosphereLTNPLLSRLLPLKPMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPPQ
Ga0126317_1024729813300011332SoilVFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVTRKHLDASWGVIAPSMRKGYTFKSWSHASELPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPAAKMRPTSFQLGLVPVLAGKDKKVWRVNYWMPRWTP
Ga0157294_1002980233300012892SoilMSVFQTALSSARFNRFLMWGSGIVLFVGGAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTFKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN*
Ga0157293_1005273723300012898SoilKPMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN*
Ga0157283_1001225733300012907SoilMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN*
Ga0157286_1010545813300012908SoilMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSTRKGYNFKSWSNGGRAQGGLPVFPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0157301_1003224033300012911SoilMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN*
Ga0157297_1024463313300012914SoilPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0164308_1090046513300012985SoilGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIADVNTTSYYLDYAATDEILLEVGVSAPGKAKLRPTTFQLGLSPVAVGKNKKKVWRVDYWMPRWTPPLPTN*
Ga0182008_1086409113300014497RhizosphereVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEDLDPEIRSTIKTFLATVVSGKDLGKSWNVSAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN*
Ga0157376_1023334043300014969Miscanthus RhizosphereMSVFQTALSSARFNRILMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTVKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIADVNTTSYYLDYAATDEILLEVGVSAPQKEKLRPTTFQLGLSPVAVGKNKKVWRVDYWMPRWTP
Ga0132255_10133854623300015374Arabidopsis RhizosphereMSVFQTALSSARFNRFLMWGSGIILFVGVAVLLMTLVKGNDKTPQGPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVTRRHLDKSWAVIGPTMRRGYTLKSWTHPGKEGLPVVPYPIADVNTTSYYLDYAATDEILLEVGVSAPEKRKMRPTTSQLGLSPVAVGKNKKKTVWRVDYWMPRWTPPLPTN*
Ga0184605_1009656133300018027Groundwater SedimentMSVFQTALSSARFNRALMWVSAAVLFAGVAVLVTSLVGGTDKTRVGNEKGFVPKLPAKSSPLQNAEGVTITKYQELDPEVRSTIRTFLATAVARKHLDQSWAVIAPSLRKGYTFQSWSHAKELPVVPYPIADVDSTKYYLDYASTKEILIEVGVSAPPAAKMRPTAFQIALVPVATGSERHWRVNYWMPRWTPPLPTN
Ga0184642_153095113300019279Groundwater SedimentSVFQTALSSARFNRALMWVSAAVLFAGVAVLVTSLVGGTDKTRVGNEKGFVPKLPAKSSPLQNAEGVTITKYQELDPEVRSTIRTFLATAVARKHLDQSWAVIAPSLRKGYTFQSWSHAKELPVVPYPIADVDSTKYYLDYASTKEILIEVGVSAPPAAKMRPTAFQIALVPVATGSERHWRVNYWMPRWTPPLPTN
Ga0173479_1024492123300019362SoilLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN
Ga0206356_1156373713300020070Corn, Switchgrass And Miscanthus RhizosphereSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVW
Ga0222624_162195413300021951Groundwater SedimentPMSVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGLSPVAV
Ga0222625_172504113300022195Groundwater SedimentPMSVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQ
Ga0222622_1047283513300022756Groundwater SedimentSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGLSPVAVGANKKVWRVDYWMPRWTPPLPTN
Ga0247745_107748113300022898SoilNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN
Ga0247788_109815813300022901SoilPVSSGHPSRGFQSLTIALLSRLHLLKPMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAK
Ga0247754_111307213300023102SoilSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN
Ga0247789_100479643300023266SoilMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN
Ga0247794_1011150023300024055SoilMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRP
Ga0207688_1005233533300025901Corn, Switchgrass And Miscanthus RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN
Ga0207659_1015935113300025926Miscanthus RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWLVDYWMPRWTPPLPTN
Ga0207686_1087579813300025934Miscanthus RhizosphereMSVFQTALSSARFNRILMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIEDVNTTSYYLDYAATDEILLEVGVSAPEKQKLRPTTFQLGLSPVAVGKNKKKVWRVDYWMPRWTPPLPTN
Ga0207670_1079403813300025936Switchgrass RhizosphereMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVW
Ga0207712_1164977013300025961Switchgrass RhizosphereTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN
Ga0207640_1158807513300025981Corn RhizosphereSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKHLDASWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPAAKMRPTSFQLGLVPVLAGKDKKVWRVNYWMPRWTPPLP
Ga0207708_1106560013300026075Corn, Switchgrass And Miscanthus RhizosphereMSVFQTALSSARFNRFLLWGSGIILFVGVVVLMMSLVKGNDTTQVNPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPQVRSTIRTFLATAVTRKHLDTSWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDFFLDYASTKEILLEVGVSAPPAAKLRPTSFQLGLVPVLAGKDKKVWRVNYWMPRWTPP
Ga0207648_1137166113300026089Miscanthus RhizosphereLILSKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN
Ga0207676_1119336823300026095Switchgrass RhizosphereSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN
Ga0207683_1009095533300026121Miscanthus RhizosphereMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0207698_1086485913300026142Corn RhizosphereGLLTIALLSRLILSKPMSVFQTALSSARFNRFLLWGSAIVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQLGLSPVKVGANKKVWRVDYWMPRWTPPLPTN
Ga0207503_101165413300026861SoilSRGFQSLTIALLSRLHLLKPMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHEGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPDAA
Ga0307291_115031613300028707SoilSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0307295_1001841013300028708SoilRLKESPAAGMASANKSATLASEPLKPMSVFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0307315_1020164113300028721SoilARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0307316_1028146513300028755SoilAVTGTCLAESPAAGMARTNKCATLASTPLKPMSVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGL
Ga0307320_1005458423300028771SoilMAQGKPTDLVHPVTVTVTVTRTCPEESPAAGMASANKCATLASTPLKPMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0307306_1019066813300028782SoilLASTPLKPMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKV
Ga0307323_1016791513300028787SoilAVTGTCLAESPAAGMARTNKCATLASTPLKPMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0307323_1034460313300028787SoilQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGLSPVAVGANKKV
Ga0307290_1008966013300028791SoilPESRMAQAKPAPLVPPVTVTAGHSSWGRRPLTIALLSASKFLKPMSVFQTALSSARFNRALMWVSAAVLFAGVAVLVTSLVGGTDKTRVGNEKGFVPKLPAKSSPLQNAEGVTITKYQELDPEVRSTIRTFLATAVARKHLDQSWAVIAPSLRKGYTFQSWSHAKELPVVPYPIADVDSTKYYLDYASTKEILIEVGVSAPPAAKMRPTAFQIALVPVATGSERHWRVNYWMPRWTPPLPTN
Ga0307292_1047842413300028811SoilARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVW
Ga0307312_1010235713300028828SoilKPMSVFQTALSSARFNRALMWVSAAVLFAGVAVLVTSLVGGTDKTRVGNEKGFVPKLPAKSSPLQNAEGVTITKYQELDPEVRSTIRTFLATAVARKHLDQSWAVIAPSLRKGYTFQSWSHAKELPVVPYPIADVDSTKYYLDYASTKEILIEVGVSAPPAAKMRPTAFQIALVPVATGSERHWRVNYWMPRWTPPLPTN
Ga0307286_1010894323300028876SoilYTPVTVTVAVTGTCLAESPAAGMARTNKCATLASTPLKPMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPPEEKLRPTAFQLGLVPVAVGKDKKVWRVNYWMPRWTPPLPTEG
Ga0307304_1029245113300028885SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0308203_107144713300030829SoilVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNY
Ga0308202_103851723300030902SoilVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0308202_104497813300030902SoilVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0308206_111129013300030903SoilSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0308206_116712013300030903SoilVFQTALSSARFNRFLMWGSAIVLFAGVAVLVTSLVKSNGGGSVGPDKGFVPKLPAKSSPLQNAQGVTITKYEELDPEVRSTIKTFLATAVKREHLDQSWGVIAPSLRKGYTFKTWSHAKALPVIPYPIEDVDSSKYFLDYASTKEILLEVGVSAPPEEKLRPTAFQLGLVPVAVGKDKKV
Ga0308200_107607813300030905SoilFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0308200_111257313300030905SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRW
Ga0308183_108853013300030988SoilSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0308183_114099813300030988SoilSVFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTQINPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKHLDASWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPSAKMRPTSFQLGLVPVLVGKDKKVWRVNYWMPRWTPP
Ga0308183_116161613300030988SoilWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLPTN
Ga0308189_1030456313300031058SoilFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTQINPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKHLDASWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPSAKMRPTSFQLGLVPVLVGKDKKVWRVNYWMPRWTPPLPTN
Ga0308189_1033764213300031058SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPL
Ga0308192_105668313300031082SoilFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPT
Ga0308201_1015531823300031091SoilVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGLSPVAVGANKKVWRVDYWMPRWTPPLPTN
Ga0308201_1022858413300031091SoilSVFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTQINPDKGFHPQLPAKSSPLQNAQGVTITKYKELDPEVRSTIRTFLATAVARKHLDASWGVIAPSMRKGYTFKSWSHAKALPVVPYPIADVDSTDYFLDYASTKEILLEVGVSAPPSAKMRPTSFQLGLVPVLAGKDKKVWRVNYWMPRWTPPLPTN
Ga0308204_1024682713300031092SoilVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGLSPVAVGANKKVWRVDYWMPRWT
Ga0308204_1032329713300031092SoilVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALNMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0308197_1035939213300031093SoilRFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRW
Ga0308197_1037409313300031093SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGK
Ga0308199_113052813300031094SoilALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPP
Ga0308193_106954613300031096SoilSMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKK
Ga0308181_111496313300031099SoilFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLP
Ga0308187_1029211513300031114SoilPMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNYWMPRWTPPLP
Ga0308187_1032741013300031114SoilMSVFQTALSSAKFNRALMWVSAVILFVGVAVLLTSLVRGSDKTSVNPDKGFHPKFQAASAPLQNKEGVTITKYDQLDPEVRSTIRTFLATAVKREHLDKSWAVIAPSMRKGYTFQSWSHAKELPVIPYPIADVDSSKYYLDYASTKEILLEVGVSAPDKAKLRPTSFQLGLSPVAVGANKKVWRVDYWMPRWT
Ga0308195_105778313300031123SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTAVNPDKGFHPQLPAKSSPLQNSQGVTITKYEELDPEVRTTIKTFLASAVARNHLDRSWGVIAPSLRKGYTFQSWSNGGKGKDGLPVIPYPIADVDSTEFFLDYASTKEILLEVGVSAPPALKMRPTSFQLGLVPVSAGKEKKVWRVNY
Ga0308151_103100413300031124SoilVFQTALSSARFNRFLLWGSGIVLFAGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPP
Ga0308194_1026609113300031421SoilSVFQTALSSARFNRALMWVSAAVLFAGVAVLVTSLVGGTDKTRVGNEKGFVPKLPAKSSPLQNAEGVTITKYQELDPEVRSTIRTFLATAVARKHLDQSWAVIAPSLRKGYTFQSWSHAKELPVVPYPIADVDSTKYYLDYASTKEILIEVGVSAPPAAKMRPTAFQIALVPVATGSERHWRVNYWMPRWTPP
Ga0308175_10120516313300031938SoilMSVFQTALSSARFNRFLMWGSGIILFVGVAVLLMTLVKGNDTTQVNPDKGFHPTLPAKSVPLQNSQGVTITKYKELDPEVRSTIKTFLSTAVARRHLDKSWGVIGPTMRKGYTFKSWTHPGKEGLPVIPYPIADVDTTTYYLDYASTDEILLEVGVSAPSKRNMRPTSFQLGMSPVAVGPNKKVWRVDYWMPRWTP
Ga0310810_1055374113300033412SoilMSVFQTALSSARFNRFLMWGSGIVLFVGVAVLLMSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNHQGVTITKYEELDPEIRSTIKTFLATVVSGKDLDKSWSVIAPSMRKGYTHKSWSNGGRAQGGLPVIPYPIADVSTSKYYLDYASTQEILLEVGVSAPNAAKTRPASFQLGLVPVSAGPQKKVWRVDYWMPRWTPPLPTN
Ga0370544_15195_48_5993300034447SoilMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLP
Ga0370548_083442_50_6103300034644SoilMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPQVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0314780_181198_1_4893300034659SoilMWGSGIVLFVGVVVLLMSFVKGNDTTSVNPDKGFHPKLPAKSSPLQNAQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSA
Ga0314782_110827_21_6323300034661SoilMSVFQTALSSARFSRFLMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPREKKMRPTSFQLGMAPVAVGPNKKVWRVDYWMPRWTPPLPTN
Ga0314782_209902_2_5083300034661SoilVAVLLMTLVKGNDETQVNPDKGFHPTLPAKSTPLHNSQGVAITKYKQLDPEVRSTIKTFLSTAVKRRHLDKSWSVIGPTMRRGYTLKSWTHPGKEGLPVIPYPIEDVNTTSYYLDYAATDEILLEVGVSAPQKEKLRPTTFQLGLSPVAVGKNKKVWRVDYWMPRWTPP
Ga0314792_154046_50_6103300034667SoilMWGSGIVLFVGVVVLLMSLVKGNDTTSVNPDKGFHPKLPAKSSPLQNSQGVTITKYEELDPEVRSTIKTFLASAVARHHLDASWGVIAPSLRKGYTFKSWSNGGKGKDGLPVIPYPIGNVNSTEYFLDYASTKEILLEVGVSAPKALKMRPTSFQLGLVPVSAGKDKKVWRVNYWMPRWTPPLPTN
Ga0314796_176529_68_5143300034671SoilVLFAGVAVLLTSLVKGNDTTAVGPDKGFHPQLPAKSSPLQNKQGVTITKYQDLDPEVRSTIKTFLATVVSGKDLDKSWSVVAPSMRKGYNFKSWSNGGRAQGGLPVIPYPIADVSSSKYYLDYASTQEILLEVGVSAPPKLNTRPASFQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.