NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068964

Metagenome Family F068964

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068964
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 49 residues
Representative Sequence PRSIQPIVQQSAQFNLVDAKLAGSTPLSAYYDNSYIDEIKRSGWLAELWR
Number of Associated Samples 111
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.16 %
% of genes from short scaffolds (< 2000 bps) 89.52 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.387 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.484 % of family members)
Environment Ontology (ENVO) Unclassified
(36.290 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.677 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.31%    β-sheet: 0.00%    Coil/Unstructured: 57.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF04909Amidohydro_2 20.97
PF01717Meth_synt_2 8.87
PF03781FGE-sulfatase 3.23
PF08240ADH_N 2.42
PF09084NMT1 1.61
PF13620CarboxypepD_reg 1.61
PF14076DUF4258 1.61
PF01850PIN 1.61
PF01061ABC2_membrane 0.81
PF13483Lactamase_B_3 0.81
PF01494FAD_binding_3 0.81
PF13379NMT1_2 0.81
PF00107ADH_zinc_N 0.81
PF12681Glyoxalase_2 0.81
PF13602ADH_zinc_N_2 0.81
PF00355Rieske 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 8.87
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 3.23
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.61
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.61
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.61
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.81
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.81
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.39 %
UnclassifiedrootN/A1.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_292996_length_1482_cov_7.367746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1514Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2228817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_221003Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1046400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300000956|JGI10216J12902_102210413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1093Open in IMG/M
3300000956|JGI10216J12902_104536817All Organisms → cellular organisms → Bacteria2091Open in IMG/M
3300003987|Ga0055471_10079822All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300003987|Ga0055471_10147201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium717Open in IMG/M
3300003987|Ga0055471_10290168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300003992|Ga0055470_10075127All Organisms → cellular organisms → Bacteria → Proteobacteria793Open in IMG/M
3300004156|Ga0062589_101757757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22621Open in IMG/M
3300004463|Ga0063356_103420508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22684Open in IMG/M
3300004463|Ga0063356_104483120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22601Open in IMG/M
3300004479|Ga0062595_100478773All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300004633|Ga0066395_10017821All Organisms → cellular organisms → Bacteria → Proteobacteria2771Open in IMG/M
3300004782|Ga0062382_10049298Not Available1541Open in IMG/M
3300005093|Ga0062594_100719218All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300005166|Ga0066674_10045968All Organisms → cellular organisms → Bacteria → Proteobacteria1961Open in IMG/M
3300005345|Ga0070692_10797750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300005356|Ga0070674_101961456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300005438|Ga0070701_10653591All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005457|Ga0070662_100438581All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300005526|Ga0073909_10025012All Organisms → cellular organisms → Bacteria1987Open in IMG/M
3300005536|Ga0070697_100074016All Organisms → cellular organisms → Bacteria → Proteobacteria2798Open in IMG/M
3300005563|Ga0068855_100074728All Organisms → cellular organisms → Bacteria3935Open in IMG/M
3300005577|Ga0068857_100161451All Organisms → cellular organisms → Bacteria2033Open in IMG/M
3300005764|Ga0066903_100972580All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300006046|Ga0066652_100105868All Organisms → cellular organisms → Bacteria → Proteobacteria2279Open in IMG/M
3300006237|Ga0097621_100236214All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300006845|Ga0075421_101248174All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300006846|Ga0075430_100266049All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300006854|Ga0075425_101052658All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium927Open in IMG/M
3300006854|Ga0075425_102631884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300006903|Ga0075426_10171586All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300006904|Ga0075424_100895372All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300006969|Ga0075419_11403793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300007076|Ga0075435_101741694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300009012|Ga0066710_100272472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2462Open in IMG/M
3300009012|Ga0066710_103984038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300009053|Ga0105095_10776259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22536Open in IMG/M
3300009087|Ga0105107_10840162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22639Open in IMG/M
3300009094|Ga0111539_13038509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300009100|Ga0075418_12980783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300009147|Ga0114129_11924746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300009148|Ga0105243_10817991All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300009148|Ga0105243_12991851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300009162|Ga0075423_12944470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300009176|Ga0105242_12084170All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009553|Ga0105249_11816741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
3300009609|Ga0105347_1016172All Organisms → cellular organisms → Bacteria → Proteobacteria2542Open in IMG/M
3300009609|Ga0105347_1153666All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009678|Ga0105252_10227379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium809Open in IMG/M
3300009818|Ga0105072_1004759All Organisms → cellular organisms → Bacteria2268Open in IMG/M
3300010048|Ga0126373_13260291All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010329|Ga0134111_10157972All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300010359|Ga0126376_12969024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300010360|Ga0126372_11813694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300010362|Ga0126377_12741820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300010375|Ga0105239_11754586All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010400|Ga0134122_12945897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300011430|Ga0137423_1166184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300011434|Ga0137464_1134459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300011434|Ga0137464_1277759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22506Open in IMG/M
3300011445|Ga0137427_10239013All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012041|Ga0137430_1024709All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300012199|Ga0137383_10298382All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300012355|Ga0137369_10113310All Organisms → cellular organisms → Bacteria → Proteobacteria2205Open in IMG/M
3300012362|Ga0137361_10808405All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300012509|Ga0157334_1070902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300012924|Ga0137413_10138310All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300012944|Ga0137410_10600942All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300012986|Ga0164304_10736526All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300013297|Ga0157378_11406882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300014154|Ga0134075_10037108All Organisms → cellular organisms → Bacteria → Proteobacteria1992Open in IMG/M
3300014269|Ga0075302_1091387All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Thiomargarita → Candidatus Thiomargarita nelsonii673Open in IMG/M
3300014311|Ga0075322_1147039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Pseudorivibacter → Pseudorivibacter rhizosphaerae577Open in IMG/M
3300014870|Ga0180080_1071744Not Available597Open in IMG/M
3300014874|Ga0180084_1039178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium922Open in IMG/M
3300014878|Ga0180065_1037664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_221018Open in IMG/M
3300015242|Ga0137412_10426496All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300015373|Ga0132257_103180680All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300017657|Ga0134074_1304715All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300017966|Ga0187776_10887461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300018063|Ga0184637_10482776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22723Open in IMG/M
3300018077|Ga0184633_10298881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300018081|Ga0184625_10481265All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300018084|Ga0184629_10126030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1279Open in IMG/M
3300018089|Ga0187774_10028700All Organisms → cellular organisms → Bacteria2283Open in IMG/M
3300018422|Ga0190265_10352201All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300018429|Ga0190272_10399080All Organisms → cellular organisms → Bacteria → Proteobacteria1121Open in IMG/M
3300018476|Ga0190274_12085300All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22664Open in IMG/M
3300019997|Ga0193711_1042055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300020021|Ga0193726_1284885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300020186|Ga0163153_10029186All Organisms → cellular organisms → Bacteria4204Open in IMG/M
3300020583|Ga0210401_11550573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300021063|Ga0206227_1096999All Organisms → cellular organisms → Bacteria → Proteobacteria578Open in IMG/M
3300021081|Ga0210379_10047208All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300021081|Ga0210379_10193981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22874Open in IMG/M
3300025312|Ga0209321_10545020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22512Open in IMG/M
3300025795|Ga0210114_1108822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22560Open in IMG/M
3300025935|Ga0207709_10947113All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300026550|Ga0209474_10133112All Organisms → cellular organisms → Bacteria1636Open in IMG/M
3300027252|Ga0209973_1063631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300027513|Ga0208685_1103915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300027775|Ga0209177_10194722All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300027840|Ga0209683_10016326All Organisms → cellular organisms → Bacteria3038Open in IMG/M
3300027873|Ga0209814_10457064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300028381|Ga0268264_10371246All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300030006|Ga0299907_10264115All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300030006|Ga0299907_10313497All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300031229|Ga0299913_10385440All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300031538|Ga0310888_10361398All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300031538|Ga0310888_10515307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22717Open in IMG/M
3300031719|Ga0306917_10843910All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300031740|Ga0307468_100655761All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300031820|Ga0307473_10546193All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031833|Ga0310917_10421665All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300031892|Ga0310893_10567590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300031908|Ga0310900_11743650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300032013|Ga0310906_10808838All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300032144|Ga0315910_10627598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_57_22833Open in IMG/M
3300033419|Ga0316601_100851283All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300033481|Ga0316600_10962814All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300033513|Ga0316628_100534648All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300033513|Ga0316628_102254678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium721Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.42%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.61%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.61%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.61%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.81%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.81%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_008036902140918013SoilWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFYAQLWR
ICChiseqgaiiDRAFT_222881723300000033SoilVKDPTVTASSXQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFYAQLWR*
AP72_2010_repI_A100DRAFT_104640013300000837Forest SoilTADSIQPIVQQSAQFNLVDAKLANSTPMTAYYDNSYIDELKRSGWLAELWK*
JGI10216J12902_10221041323300000956SoilQPIVQQAAEWNQIDAKLAASTPTSAYYDNSYIDEIKKSGFFAQLWR*
JGI10216J12902_10453681743300000956SoilQPIVQQAAEWNQIDAKLAASTPTGAYYDNSYIDEIKKSGFFAQLWR*
Ga0055471_1007982213300003987Natural And Restored WetlandsQPIVQQSTEFNVVDAKLAASTPISAYYDNSYIDEIKKSGFFTQLWK*
Ga0055471_1014720123300003987Natural And Restored WetlandsQPIVQQSTEFNVVDAKLAANTPISAYYDNSYIDEIKKSGFFTQLWK*
Ga0055471_1029016823300003987Natural And Restored WetlandsPSSIQPIVQQLIESNLVDTKLANSTPLSAYYDNSYIDEIKKSGFFAQLWR*
Ga0055470_1007512723300003992Natural And Restored WetlandsLIEFGLVDPNLASTTPVSAYYDNSYIEEIKKSGFFAQLWR*
Ga0062589_10175775723300004156SoilIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFYAQLWR*
Ga0063356_10342050823300004463Arabidopsis Thaliana RhizospherePIVQQSAQFNIVDAKLAGSTPLSAYYDNSYIDEIKRSGFFAQLWK*
Ga0063356_10448312023300004463Arabidopsis Thaliana RhizospherePIVQQSAQFNIVDAKLAGSTPMSAYYDNSYIDEIKKSGFFTQLWK*
Ga0062595_10047877313300004479SoilDPTVTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR*
Ga0066395_1001782113300004633Tropical Forest SoilIKDPTVSPASIQPIVQHAVQWNLVDAKAANGTPLTAYYDNSYVEEIKKSGFFAELWK*
Ga0062382_1004929823300004782Wetland SedimentVTASSIQPIVQQAAEWNQIDAKLTASTPTGAYYDNSYIDEIKKSGFFAQLWR*
Ga0062594_10071921813300005093SoilPIVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR*
Ga0066674_1004596813300005166SoilKDPTISPVSIQPIVQQSAQWNLVDAKLATSTPLSAYYDNSYVEEIKRSGFLSELWR*
Ga0070692_1079775023300005345Corn, Switchgrass And Miscanthus RhizosphereVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR*
Ga0070674_10196145623300005356Miscanthus RhizosphereKDPTVTPGSIRPIVQQSTEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK*
Ga0070701_1065359113300005438Corn, Switchgrass And Miscanthus RhizosphereSIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR*
Ga0070662_10043858113300005457Corn RhizosphereDPTVTPGSIRPIVQQSTEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK*
Ga0073909_1002501233300005526Surface SoilIFVKDPTVTPGSIQPILQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR*
Ga0070697_10007401633300005536Corn, Switchgrass And Miscanthus RhizosphereDPTVSPASIQPIVQHAVQWNLVDAKAANSTPLTAYYDNSYVEEIKKSGFFTELWK*
Ga0068855_10007472863300005563Corn RhizosphereEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK*
Ga0068857_10016145113300005577Corn RhizosphereATDIFVKDPTVTPGSIRPIVQQSAEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK*
Ga0066903_10097258033300005764Tropical Forest SoilFVKDPTVTPDSIQPIVQQSAQFNLVDAKLANSTPMTAYYDNSYIEELKRSGWLAELWK*
Ga0066652_10010586833300006046SoilYVKDPTVSPVSIQPIVQQSAQWNLVDAKLASSTPLSAYYDNSYVEEIKRSGFLSELWR*
Ga0097621_10023621433300006237Miscanthus RhizosphereVTPGSIRPIVQQSTEFNLIDAQLAANTPVSAYYDNSYVEEIKRSRWLAELWK*
Ga0075421_10124817413300006845Populus RhizosphereIFVKDPTVTPGSIRPIIQQSTEFNLIDAKLAATTAVSAYYDNSYVEEIKRSGWLADLWK*
Ga0075430_10026604923300006846Populus RhizosphereSASIQPIVQQSAQFNLVDAKLAGSTPIAAYYDNSYVDEIKKSGWLADLWR*
Ga0075425_10105265813300006854Populus RhizosphereQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK*
Ga0075425_10263188423300006854Populus RhizosphereLDVFVKDPTVSPSSIQPIVQHAVQWNLVDAKVANSTPLAAFYDNSYVEEIKRSGFFAELWK*
Ga0075426_1017158613300006903Populus RhizosphereTPGSIRPIVQQSTEFNLIDAKLAATTPASAYYDNSYVDEIKRSGWLAELWR*
Ga0075424_10089537223300006904Populus RhizosphereVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR*
Ga0075419_1140379323300006969Populus RhizosphereSAQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK*
Ga0075435_10174169423300007076Populus RhizosphereIVQQSTEFNLIDAQLAANTPVSAYYDNSYVEEIKRSRWLAELWK*
Ga0066710_10027247213300009012Grasslands SoilQFNLVDAKLAGSTPLSAYYDNSYIDEIKRSGWLAELWR
Ga0066710_10398403823300009012Grasslands SoilVFIKDPTVTAASIQPIVQQSAQFNLVDAKLANSTPLTAYYDNSYVEELKRSGWLAELWK
Ga0105095_1077625923300009053Freshwater SedimentVKDPAVTPGSIQPIVQQSAQFNLIDAKLAATTPVSAYYDNSYVDEIKKSGFFTQLWK*
Ga0105107_1084016213300009087Freshwater SedimentDPAVTPGSIQPIVQQSAQFNLVDAKLAASTPVSAYYDNSYVDEIKKSGFFAQLWK*
Ga0111539_1303850913300009094Populus RhizosphereTEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR*
Ga0075418_1298078313300009100Populus RhizosphereDPTVTSASIQPIVQQSAQFNLVDAKLAGSTPIAAYYDNSYVDEIKKSGWLADLWR*
Ga0114129_1192474613300009147Populus RhizospherePRSIQPIVQQSAQFNLVDAKLAGSTPLSAYYDNSYIDEIKRSGWLAELWR*
Ga0105243_1081799123300009148Miscanthus RhizosphereIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR*
Ga0105243_1299185123300009148Miscanthus RhizosphereTVTAGSIRPIVQQSTEFNLIDAKLAANTPVSAYYDNSYVEEIKRSGWLAELWK*
Ga0075423_1294447023300009162Populus RhizosphereVTADSIQPIVQQSAQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK*
Ga0105242_1208417023300009176Miscanthus RhizosphereIQPIVQQAAEWNQIDAKQAAATLVSTYYDNSYIDEIKKSGFFAQLWR*
Ga0105249_1181674123300009553Switchgrass RhizosphereFVKDPTVTPDSIRPIVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR*
Ga0105347_101617213300009609SoilQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR*
Ga0105347_115366613300009609SoilKDPTVNASSIQPIVQQAAEWNQIDAKMAASTPTSAYYDNSYIEEIKKSGFFAQLWR*
Ga0105252_1022737913300009678SoilQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR*
Ga0105072_100475913300009818Groundwater SandQSAQFNLVDAKLANSTPLTAYYDNSYVDELKRSGWLAELWK*
Ga0126373_1326029113300010048Tropical Forest SoilDPTVSFASIQPIVQHAVQWNLVDAKAANSTPLTAYYDNSYVEEIKRSGFFAELWK*
Ga0134111_1015797213300010329Grasslands SoilWNLVDAKLASSTPLSAYYDNSYVEEIKRSGFLSELWR*
Ga0126376_1296902413300010359Tropical Forest SoilTEFNLIDAKLSATTPVSAYYDNSYVEEIKRSGWLAELWK*
Ga0126372_1181369413300010360Tropical Forest SoilPSSIQPIVQQSAQWNLIDAKLASSTPLSAYYDNSYVDEINLSGFFSELWK*
Ga0126377_1274182023300010362Tropical Forest SoilVDAKMAHTTPMTAYYDNTYVEELKRSGWLAELWK*
Ga0105239_1175458613300010375Corn RhizosphereSTEFNLIDAQLAANTPVSAYYDNSYVEEIKRSRWLAELWK*
Ga0134122_1294589723300010400Terrestrial SoilTAQSIQPIVQQSAQFNLVDAKLAANTPLSAYYDNSYIDEIKKSGFFSQLWK*
Ga0137423_116618413300011430SoilVTASSIQPIVQQAAEWQQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR*
Ga0137464_113445913300011434SoilPIVQQAAEWQQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR*
Ga0137464_127775923300011434SoilNSIQPIVQQSAQFNLIDTKLANATPMSAYYDNIYIDEIKRSGWLAELWR*
Ga0137427_1023901333300011445SoilSIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR*
Ga0137430_102470923300012041SoilKDPTVTASSIQPIVQQAAEWNQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR*
Ga0137383_1029838223300012199Vadose Zone SoilVDAKLAGGTPTSDYSDNSYVEEIKRAGWLAELWR*
Ga0137369_1011331033300012355Vadose Zone SoilFLVDTKLAGSMPLSAYYDNSFVEEIKRSGWLAELWR*
Ga0137361_1080840513300012362Vadose Zone SoilADSIQPIVQQSVQFNLVDAKAASSVPLSAYYDNSYVEELKRSGWLAELWK*
Ga0157334_107090213300012509SoilDIFVKDPTVTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR
Ga0137413_1013831013300012924Vadose Zone SoilFNLVDAKLAGNTPIAAYYDNSYVDEIKKSGWLADLWR*
Ga0137410_1060094213300012944Vadose Zone SoilLDVFVKDPTVTPGSIQPIVQQSAQFNLIDAKLAGSTPIGAYYDNSYVDEIKRTGWLADLWR*
Ga0164304_1073652613300012986SoilTVTPDSIRPIVQQATEFNLIDAKLAANTPLSAYYDNSYAEEIKRSGWLTELWR*
Ga0157378_1140688223300013297Miscanthus RhizosphereVQQSTEFNLIDAKLAANTPVSAYYDNSYVEEIKRSGWLAELWK*
Ga0134075_1003710833300014154Grasslands SoilLEVYVKDPTVSPVSIQPIVQQSAQWNLVDAKLATSTPLSAYYDNSYVEEIKRSGFLSELWR*
Ga0075302_109138723300014269Natural And Restored WetlandsPIVQQSAQFNLVDTKLANATPMSAYYDNSYVEEIKRSGWLAELWR*
Ga0075322_114703913300014311Natural And Restored WetlandsSIQPVVQQLIESNLIDSKIAGATPVSAYYDDSYIAVIKKSGFYAQLWPRS*
Ga0180080_107174413300014870SoilIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLWR*
Ga0180084_103917813300014874SoilQSAQWNLIDAKAANSTPLSAYYDNSYVDEIKQSGFLAELWR*
Ga0180065_103766413300014878SoilPTVTPGSIQPIVQQSAQWNLIDAKAANSTPLSAYYDNSYVDEIKRSGFLAELWK*
Ga0137412_1042649623300015242Vadose Zone SoilAHALVDAKLAGNTPIGAYYDNSYVDEIKRAGWLADLWR*
Ga0132257_10318068013300015373Arabidopsis RhizosphereTVTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR*
Ga0134074_130471523300017657Grasslands SoilVSIQPIVQQSAQWNLVDAKLASSTPLSAYYDNTYVEEIKRSGFLSELWR
Ga0187776_1088746113300017966Tropical PeatlandKDPTVTPSSIQPIVQQSAQFNLIDVKLANSTPLSAYYDNSYIEEIKKSGFFAQLWR
Ga0184637_1048277613300018063Groundwater SedimentPIVQQSAQFNLIDAKLANNTPLSAYYDNNYIEEIKRSGWLAELWR
Ga0184633_1029888123300018077Groundwater SedimentRFALDIYVKDPTVTASSIQPIIQQAAEWNQIDAKLASATPTSAYYDNSYIEEIKKSGFFAQLWR
Ga0184625_1048126523300018081Groundwater SedimentDSIQPIVQQSAQFNLVDVKLATSTPMTAYYDNSYVEELKRSGWLAELWK
Ga0184629_1012603013300018084Groundwater SedimentPIVQQSAQFNLIDTKLANATPMSAYYDNSYVDEIKRSGWLAELWR
Ga0187774_1002870013300018089Tropical PeatlandIQPIVQQSAQFNLIDVKLANSTPLSAYYDNSYIDEIKRSGWLAELWR
Ga0190265_1035220133300018422SoilFNLIDAKLAATTPVSAYYDNSYVDEIKKSGFFTQLWK
Ga0190272_1039908033300018429SoilVQQAAEWNQIDAKLAASTPTSAYYDNSFIDEIKKSGFFAQLWK
Ga0190274_1208530013300018476SoilQQSAQFNLVEAKLASNTPMSAYYDNSYVDDLKRSGWLAELWR
Ga0193711_104205513300019997SoilFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR
Ga0193726_128488513300020021SoilFALDIFVKDPTVTAQSIQPIVQQSAQFNLVDAKLAANTPLSAYYDNSYIDAIKKSGFFSQLWK
Ga0163153_1002918653300020186Freshwater Microbial MatVTASSIQPIVQQAAEWNQIDAKLAASTQTSAYYDNSYIEEIKKSGFFAQLWR
Ga0210401_1155057313300020583SoilSIQPIVQHAVQWNLVEAKAANSTPMSAYYDNSYVEEIKKSGFFTELWK
Ga0206227_109699923300021063Deep Subsurface SedimentIQPIVQQSAQFNLVDAKLAGSTPITAYFDNSYVDEIKRTGWLTELWR
Ga0210379_1004720833300021081Groundwater SedimentAQFNLVDGKLANSTPMTAYYDNSYVEELKRSGWLAELWK
Ga0210379_1019398123300021081Groundwater SedimentVTPGSIQPIVQQSAQWNLIDAKAANSTPLSAYYDNSYVDEIKRSGFLAELWK
Ga0209321_1054502013300025312SoilYVKDPTVTPSSIQPIVQQLVESGLIDAKLANTTPLSAYYDNSYIDEIKRSGFFAQLWK
Ga0210114_110882213300025795Natural And Restored WetlandsFLLSASAYAAPASIQPIVQQSAHWHLIDVKAAGATRLSAYCDNSYVDEIKRSGFLAELWK
Ga0207709_1094711313300025935Miscanthus RhizosphereVTPGSIRPIVQQSAEFNLIDAKLAANTPVSVYYDNSYVEEIKRSGWLAELWK
Ga0209474_1013311233300026550SoilQWNLVDAKLASSTPLSAYYDNSYVEEIKRSGFLSELWR
Ga0209973_106363113300027252Arabidopsis Thaliana RhizospherePIVQQSAEFNVVDAKLASNTPIGAYYDNSYIEEIKKSGFFTQLWK
Ga0208685_110391523300027513SoilLDIYVKDPTVTASSIQPIVQQAAEWQQIDAKLAASTPTNAYYDNSYIEEIKKSGFFAQLW
Ga0209177_1019472223300027775Agricultural SoilPTVTSDSIRPIVQQSTEFNLIDAKLAANTPMSAYYDNSYVEEIKRSGWLAELWK
Ga0209683_1001632633300027840Wetland SedimentVTASSIQPIVQQAAEWNQIDAKLTASTPTGAYYDNSYIDEIKKSGFFAQLWR
Ga0209814_1045706423300027873Populus RhizosphereAQFNLVDPKLANSTPMTAYYDNSYVEELKRSGWLTELWK
Ga0268264_1037124613300028381Switchgrass RhizosphereIQPIVQQSAQFNLVDARLAGSTPIGAYYDNSYVDEIKRAGWLADLWR
Ga0299907_1026411513300030006SoilDIYVKDPTVTPSSIQPIVQQLVESGLIDAKLANTTPLSAYYDNSYIDEIKRSGFFAQLWK
Ga0299907_1031349723300030006SoilIFVKDPTVTLGSIQPIVQQSAQWNLIDAKAAVATPLSAYYDNSYVDEIKRSGFLAELWK
Ga0299913_1038544013300031229SoilALDIFVKDPTVTAGSIQPIVQQSAQWNLIDAKAAVATPLSAYYDNSYVDEIKRSGFLAELWK
Ga0310888_1036139823300031538SoilIRPIVQQSTEFNLIDAKLAANTPVSAYYDNSYVEEIKRSGWLAELWK
Ga0310888_1051530723300031538SoilAAEWQQIDAKLAASTPTSAYCDNSYIEEIKKSGFFPQIWR
Ga0306917_1084391023300031719SoilDVFVRDPTVTPNSIQPIVHQSVQFNLVDAKVANSTPLTAYYDNSYVEELKRSGWLAELWK
Ga0307468_10065576113300031740Hardwood Forest SoilTPASIQPIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKRAGWLADLWR
Ga0307473_1054619323300031820Hardwood Forest SoilVFIKDPTVSPASIQPIVQHAVQWNLVDAKAANSTPLTAYYDNSYVEEIKKSGFFTELWK
Ga0310917_1042166513300031833SoilVTPGSIRPIVQQSTEFNLIDSKLAGNTPVSAYYDNSYIEEIKRSGWLAELWR
Ga0310893_1056759023300031892SoilPASIQPIVQQSAQFNLIDAKLAGNTPIGAYYDNSYVDEIKRSGWLADLWR
Ga0310900_1174365013300031908SoilSAQFNLVDAKLVNSTPLTAYYDNSYVDELKRSGWLAELWK
Ga0310906_1080883823300032013SoilIVQQSAQFNLVDAKLAGSTPIGAYYDNSYVDEIKKSGWLADLWR
Ga0315910_1062759813300032144SoilIVDAKTAGNTPMSAYYDNSYIEEIKKSGFFAQLWK
Ga0316601_10085128333300033419SoilTVTASSIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR
Ga0316600_1096281413300033481SoilKAPTVTASSIQPIVQQAAEWQQIDAKLAASTPTSAYYDNSYIEEIKKSGFFAQLWR
Ga0316628_10053464813300033513SoilLIESNLVDAKLANATPLSAYYDNSYIEEIKKSGFFAQLWR
Ga0316628_10225467823300033513SoilQLIESNLVDTKLANSTPLSAYYDNSYIEEIKKSGFFAQLWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.