NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F069058

Metagenome Family F069058

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069058
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 42 residues
Representative Sequence EVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY
Number of Associated Samples 110
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.16 %
% of genes from short scaffolds (< 2000 bps) 85.48 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.258 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.742 % of family members)
Environment Ontology (ENVO) Unclassified
(27.419 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.29%    β-sheet: 0.00%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF02219MTHFR 13.71
PF00004AAA 5.65
PF01135PCMT 4.84
PF12697Abhydrolase_6 3.23
PF03401TctC 2.42
PF08238Sel1 2.42
PF02668TauD 2.42
PF13207AAA_17 1.61
PF13340DUF4096 0.81
PF01418HTH_6 0.81
PF00149Metallophos 0.81
PF07724AAA_2 0.81
PF12695Abhydrolase_5 0.81
PF00089Trypsin 0.81
PF08352oligo_HPY 0.81
PF00180Iso_dh 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG06855,10-methylenetetrahydrofolate reductaseAmino acid transport and metabolism [E] 13.71
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 4.84
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 4.84
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 4.84
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 4.84
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 2.42
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.42
COG1737DNA-binding transcriptional regulator, MurR/RpiR family, contains HTH and SIS domainsTranscription [K] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.26 %
UnclassifiedrootN/A17.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100497437All Organisms → cellular organisms → Bacteria → Proteobacteria2306Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1072184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1027929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium887Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1038793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium739Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1007636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1441Open in IMG/M
3300000890|JGI11643J12802_11735067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti784Open in IMG/M
3300000890|JGI11643J12802_11937086All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300000956|JGI10216J12902_109294776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria980Open in IMG/M
3300002459|JGI24751J29686_10010444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1914Open in IMG/M
3300002911|JGI25390J43892_10076820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300004479|Ga0062595_100523608All Organisms → cellular organisms → Bacteria → Proteobacteria898Open in IMG/M
3300005175|Ga0066673_10333053All Organisms → cellular organisms → Bacteria → Proteobacteria886Open in IMG/M
3300005181|Ga0066678_11105473All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005332|Ga0066388_103149534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300005353|Ga0070669_100644790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae891Open in IMG/M
3300005436|Ga0070713_101967226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300005471|Ga0070698_101339741All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300005539|Ga0068853_100237098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1671Open in IMG/M
3300005546|Ga0070696_100527911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300005549|Ga0070704_100410494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1157Open in IMG/M
3300005553|Ga0066695_10836010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300005555|Ga0066692_10056395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2203Open in IMG/M
3300005556|Ga0066707_10165226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1411Open in IMG/M
3300005568|Ga0066703_10647548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300005713|Ga0066905_101011656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria733Open in IMG/M
3300005713|Ga0066905_102083475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300005764|Ga0066903_100524642Not Available2018Open in IMG/M
3300005843|Ga0068860_102411376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300006028|Ga0070717_10172944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1879Open in IMG/M
3300006038|Ga0075365_10148095All Organisms → cellular organisms → Bacteria → Proteobacteria1632Open in IMG/M
3300006178|Ga0075367_10772182Not Available612Open in IMG/M
3300006871|Ga0075434_100260821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1752Open in IMG/M
3300009036|Ga0105244_10590458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300009551|Ga0105238_12996747Not Available507Open in IMG/M
3300010046|Ga0126384_10112563Not Available2032Open in IMG/M
3300010046|Ga0126384_11321327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300010047|Ga0126382_11568481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300010358|Ga0126370_10143197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1731Open in IMG/M
3300010359|Ga0126376_10338434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1328Open in IMG/M
3300010360|Ga0126372_11032855All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300010360|Ga0126372_11894963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
3300010366|Ga0126379_12016805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium679Open in IMG/M
3300010376|Ga0126381_100803402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1351Open in IMG/M
3300010398|Ga0126383_11111859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria880Open in IMG/M
3300010400|Ga0134122_12467846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales568Open in IMG/M
3300012200|Ga0137382_10780410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300012212|Ga0150985_121973874Not Available502Open in IMG/M
3300012361|Ga0137360_10022892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4205Open in IMG/M
3300012469|Ga0150984_104133091All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300012582|Ga0137358_10618755Not Available726Open in IMG/M
3300012896|Ga0157303_10022793All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300012917|Ga0137395_10201159Not Available1386Open in IMG/M
3300012924|Ga0137413_11011004Not Available652Open in IMG/M
3300012929|Ga0137404_10883082Not Available815Open in IMG/M
3300012948|Ga0126375_10052006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2188Open in IMG/M
3300012957|Ga0164303_10067317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1657Open in IMG/M
3300012957|Ga0164303_10927223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300012961|Ga0164302_11792441Not Available518Open in IMG/M
3300012971|Ga0126369_10315447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1571Open in IMG/M
3300012988|Ga0164306_10227928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1323Open in IMG/M
3300012988|Ga0164306_10903131Not Available720Open in IMG/M
3300013297|Ga0157378_12666216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales552Open in IMG/M
3300013306|Ga0163162_11646622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae732Open in IMG/M
3300014969|Ga0157376_11857540All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300015264|Ga0137403_10513929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1068Open in IMG/M
3300016319|Ga0182033_10831671Not Available815Open in IMG/M
3300016357|Ga0182032_10112234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1949Open in IMG/M
3300016357|Ga0182032_11693215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici551Open in IMG/M
3300016357|Ga0182032_11777395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300016371|Ga0182034_10108231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2009Open in IMG/M
3300016404|Ga0182037_10775322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria825Open in IMG/M
3300017792|Ga0163161_11805421All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300018055|Ga0184616_10215028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae723Open in IMG/M
3300020001|Ga0193731_1066812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae942Open in IMG/M
3300025910|Ga0207684_10727353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria842Open in IMG/M
3300025938|Ga0207704_10370162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1122Open in IMG/M
3300025972|Ga0207668_10562290All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300026277|Ga0209350_1086227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria823Open in IMG/M
3300026326|Ga0209801_1320122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300026494|Ga0257159_1099663Not Available509Open in IMG/M
3300026523|Ga0209808_1119048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1086Open in IMG/M
3300026524|Ga0209690_1149018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria861Open in IMG/M
3300027181|Ga0208997_1033911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300027646|Ga0209466_1030088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1114Open in IMG/M
3300027654|Ga0209799_1065443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium816Open in IMG/M
3300027874|Ga0209465_10448964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici645Open in IMG/M
3300028536|Ga0137415_11447377Not Available511Open in IMG/M
3300028721|Ga0307315_10140382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae729Open in IMG/M
3300031199|Ga0307495_10183465Not Available564Open in IMG/M
3300031546|Ga0318538_10339685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300031682|Ga0318560_10028605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2616Open in IMG/M
3300031736|Ga0318501_10039979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2133Open in IMG/M
3300031744|Ga0306918_10592915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria868Open in IMG/M
3300031751|Ga0318494_10414055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria782Open in IMG/M
3300031769|Ga0318526_10123229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1046Open in IMG/M
3300031779|Ga0318566_10052728All Organisms → cellular organisms → Bacteria → Proteobacteria1936Open in IMG/M
3300031797|Ga0318550_10000459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10819Open in IMG/M
3300031805|Ga0318497_10665779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici584Open in IMG/M
3300031832|Ga0318499_10179323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria826Open in IMG/M
3300031859|Ga0318527_10321256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300031860|Ga0318495_10236933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria818Open in IMG/M
3300031912|Ga0306921_11123615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300031912|Ga0306921_12248695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300031941|Ga0310912_10883125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300031942|Ga0310916_11397327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300031942|Ga0310916_11573249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici534Open in IMG/M
3300031954|Ga0306926_11473551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria786Open in IMG/M
3300031981|Ga0318531_10235597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria826Open in IMG/M
3300031981|Ga0318531_10543744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria526Open in IMG/M
3300032009|Ga0318563_10032972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2599Open in IMG/M
3300032009|Ga0318563_10784869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici510Open in IMG/M
3300032010|Ga0318569_10419237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici624Open in IMG/M
3300032051|Ga0318532_10225165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300032060|Ga0318505_10018791All Organisms → cellular organisms → Bacteria → Proteobacteria2661Open in IMG/M
3300032076|Ga0306924_10786820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici1062Open in IMG/M
3300032180|Ga0307471_102334656Not Available675Open in IMG/M
3300032261|Ga0306920_102113164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria785Open in IMG/M
3300032261|Ga0306920_103694710Not Available562Open in IMG/M
3300033550|Ga0247829_10954959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae713Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.23%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10049743713300000559SoilDRAKTDFVAQEIAAMAITAPRKVSADDVRTLLAAAG*
AP72_2010_repI_A01DRAFT_107218413300000579Forest SoilGFPIPQRLLEVGFDRAKTDFVAREVEAMAISVPRKVSAEDVRALLAAAY*
AF_2010_repII_A01DRAFT_102792943300000580Forest SoilRLSEVGFDRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD*
AF_2010_repII_A01DRAFT_103879313300000580Forest SoilFDRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD*
AP72_2010_repI_A10DRAFT_100763623300000651Forest SoilLEVGFDRAKTDFVAREVEAMAISVPRKVSAEDVRALLAAAY*
JGI11643J12802_1173506713300000890SoilGKVDFVAGEVAAMSISAPRKVSAEDVRTLLSAAY*
JGI11643J12802_1193708633300000890SoilAKVDFVAGEVAAMSISAPRKVSAEDVRALLAAAY*
JGI10216J12902_10929477613300000956SoilQRLAEVGFDRAKTDFVTQEVAALKITAPRKVSAEDVRTLLAAAD*
JGI24751J29686_1001044413300002459Corn, Switchgrass And Miscanthus RhizosphereAEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY*
JGI25390J43892_1007682023300002911Grasslands SoilEVGFDRAKTDFVAQEVAAMAISVPRKLSAEDVRTLLAAAY*
Ga0062595_10052360823300004479SoilLTEVGFDRRKTDFVAPEIAAMGIGVPRKVSAEDARMLLAAAD*
Ga0066673_1033305313300005175SoilLTEVGFDRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD*
Ga0066678_1110547323300005181SoilIPQRLREVGFDRDKIEFVASEVAGMAISAPRPVSAADVRALLAAAS*
Ga0066388_10314953413300005332Tropical Forest SoilSLPIPHRLSQVGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF*
Ga0070669_10064479013300005353Switchgrass RhizosphereEVGFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY*
Ga0070713_10196722613300005436Corn, Switchgrass And Miscanthus RhizospherePIPQRLAEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY*
Ga0070698_10133974123300005471Corn, Switchgrass And Miscanthus RhizosphereGEVGFDRAKIDFVAGEVAALSISAPRKVSAEDVRALLAAAY*
Ga0068853_10023709813300005539Corn RhizosphereVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY*
Ga0070696_10052791123300005546Corn, Switchgrass And Miscanthus RhizosphereEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY*
Ga0070704_10041049423300005549Corn, Switchgrass And Miscanthus RhizosphereEVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY*
Ga0066695_1083601013300005553SoilEVGFDRAKTDFVAQEIAAMKILAPRKVLAEDVRTLLAAAA*
Ga0066692_1005639513300005555SoilGFPIPQRLREVGFDRAKTDFVAQEVAAMAISVPRKLSAEDVRTLLAAAY*
Ga0066707_1016522613300005556SoilFDRAKTDFVAQEVAAMSITVPCKVSAEDVRTLLAAAY*
Ga0066703_1064754823300005568SoilDRAKTDFVAQEIAAMKILAPRKVLAEDVRTLLAAAA*
Ga0066905_10101165613300005713Tropical Forest SoilLLEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAW*
Ga0066905_10208347513300005713Tropical Forest SoilFDRAKADFVAQEVEAMAISVPRKVAAEDVRTLLAAAY*
Ga0066903_10052464213300005764Tropical Forest SoilGFPIPQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRTLLAAAY*
Ga0068860_10241137623300005843Switchgrass RhizosphereRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD*
Ga0070717_1017294443300006028Corn, Switchgrass And Miscanthus RhizosphereRLREVGFDRAKTDFIAQEVAAMSISVPRKVSAEDVRALLAAAY*
Ga0075365_1014809533300006038Populus EndosphereVGFDRAKADFVATEVEKLSISAPRTVSADDVRAVLAAAY*
Ga0075364_1012741133300006051Populus EndosphereGLDRGKIDFVATEVAKLAIAVPRKVSADDVRALLAAAY*
Ga0075367_1077218223300006178Populus EndospherePIPHRLAEVGFDRAKVDFVADEVAAMSISAPRTVSADDVRAVLAAAY*
Ga0075431_10035023723300006847Populus RhizosphereDRGKIDFVAAEMAALAIRVPREVSARDVCALLAAAY*
Ga0075434_10026082133300006871Populus RhizosphereFDRGKTDFAAQEIAAMGISVPRKVSAEDVRMLLAAAD*
Ga0105244_1059045823300009036Miscanthus RhizospherePQRLAEVGFDRAKVDFVSGEVAAMSISAPRTVSADDVRAVLAAAY*
Ga0105238_1299674723300009551Corn RhizosphereGFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY*
Ga0126384_1011256323300010046Tropical Forest SoilEVGFDRAKTDFVAREVEAMSITVPRKVSAADVCTLLAAAW*
Ga0126384_1132132713300010046Tropical Forest SoilPQRLSEVGFDRTKTDFVAQEIAAMAISVPRKVSADDVRALLAAA*
Ga0126382_1156848123300010047Tropical Forest SoilFPIPQRLLEVGFDRAKADFVAQEVEAMAISVPRKVAAEDVRTLLAAAY*
Ga0126370_1014319723300010358Tropical Forest SoilIPQRLLEVGFDRAKTDFVAREVEAMAISVPRKVSAEDVHTLLAAAW*
Ga0126376_1033843423300010359Tropical Forest SoilFPIPQKLSEVGFDRGKIDFVADEVAAMAIKMPRPASAEDVRGLLAAAY*
Ga0126372_1103285513300010360Tropical Forest SoilGKIDFVAKEVAALGIKVPRPVAAEDVRALLAAAY*
Ga0126372_1189496323300010360Tropical Forest SoilFDRAKTDFVAQEVAAMAISLPRKVSAEDVRTLLAAAY*
Ga0126379_1201680533300010366Tropical Forest SoilRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD*
Ga0126381_10080340213300010376Tropical Forest SoilIPQRLLEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVHTLLAAAW*
Ga0126383_1111185923300010398Tropical Forest SoilFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAY*
Ga0134122_1246784623300010400Terrestrial SoilRGFPIPRRLAEVGFDRAKADFVASEVEKLSISAPRTVSADDVRAVLAAAY*
Ga0137382_1078041023300012200Vadose Zone SoilLREVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAH*
Ga0150985_12197387413300012212Avena Fatua RhizosphereDVGFDRTKAEFVAGEIAAMAISVPRKVSAADVRTLLEAAY*
Ga0137360_1002289213300012361Vadose Zone SoilLREVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY*
Ga0150984_10413309113300012469Avena Fatua RhizosphereFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY*
Ga0137358_1061875513300012582Vadose Zone SoilVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY*
Ga0157303_1002279313300012896SoilRFDRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD*
Ga0137395_1020115923300012917Vadose Zone SoilPIPQRLGEVGFDRAKTDFVAQEIAAMKIFSPRKVSAEDVRTLLAAAY*
Ga0137413_1101100423300012924Vadose Zone SoilSDVGFDRAKTDFVAGEIAAMALSVPRRVSADDLRALLQAAY*
Ga0137404_1088308223300012929Vadose Zone SoilSDVGFDRTKAEFVAGEIAAMAISVPRKVSAADVRVLLEAAY*
Ga0126375_1005200633300012948Tropical Forest SoilGLGKVGFDRAKTEFVAQEIAAMKILTPRKVSAEDVRTLLAAAY*
Ga0164303_1006731733300012957SoilFDRAKVDFVADEVAAMSINAPRKVSADDVRAVLAAAY*
Ga0164303_1092722313300012957SoilEVGFDRAKVDFVSGEVAAMSISAPREVSADDVRAVLAAAY*
Ga0164302_1179244113300012961SoilEVGFDRAKADFVASEVEKLSISAPRTVSADDVRAVLAAAY*
Ga0126369_1031544733300012971Tropical Forest SoilGFDRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD*
Ga0164306_1022792813300012988SoilEVRFDRRKTDFVAQEIAAMGISVPRKVSAEDVRMLLAAAD*
Ga0164306_1090313113300012988SoilFPIPRRLAEVGFDRAKVDFVADEVAAMSINAPRKVSADDVRAVLAAAY*
Ga0157378_1266621623300013297Miscanthus RhizosphereLAEVGFDRAKADFVASEVEKLSISAPRTVSADDVRAVLAAAY*
Ga0163162_1164662223300013306Switchgrass RhizosphereGFDRAKADFVATEVEKLSISAPRTVSADDVRAVLAAAY*
Ga0157376_1185754023300014969Miscanthus RhizosphereFPIPQRLAEVGFDRAKVDFVADEVAAMSINAPRKVSADDVRAVLAAAY*
Ga0137403_1051392933300015264Vadose Zone SoilRLVEVGFDRAKTDFVAQEIVAMAITVPRKVSADDVRALLAAAG*
Ga0182033_1083167113300016319SoilKLSDVGFDPARIDFVAGEVAAMAINSPRKVSAADVRALLQSAC
Ga0182032_1011223433300016357SoilFDRAKTDFVAREVEAMTISVPRKVAAEDVRTLLAAAY
Ga0182032_1169321513300016357SoilRAKTDFVAQEVAAMAITVPRKVSAEDVRALLAAAY
Ga0182032_1177739523300016357SoilLLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW
Ga0182034_1010823123300016371SoilRGFPIPQRLREVGFDRAKTDFVAQEVAAMAISIPRKVSAEDVRTLLAAAY
Ga0182037_1077532213300016404SoilREVGFDRAKTDFVAQEVAAMAISIPRKVSAEDVRTLLAAAY
Ga0163161_1180542123300017792Switchgrass RhizosphereFPIPQRLAEVGFDSAKVDFVAGEVAAMSISAPRKVSAEDVRALLAAAY
Ga0184616_1021502813300018055Groundwater SedimentPQRLAEVGFDRAKVDFVSGEVAAMSISAPRKVSADDVRAVLAAAY
Ga0193731_106681213300020001SoilAEVGFDRAKVDFVAGEVAAMSISAPRKVSADDVRAVLAAAY
Ga0207684_1072735323300025910Corn, Switchgrass And Miscanthus RhizosphereFDRAKTDFVAQEVEAMAISVPRKVSAEDVRTLLAAAY
Ga0207700_1190430613300025928Corn, Switchgrass And Miscanthus RhizosphereRDKIEFIAAEVGKLAIAVPRPVSGADVRALLAAAY
Ga0207704_1037016213300025938Miscanthus RhizosphereRAKVDFVADEVAAMSISAPRTVSADDVRAVLAAAY
Ga0207668_1056229013300025972Switchgrass RhizosphereRAKVDFVAGEVAAMSISAPRKVSAEDVRALLAAAY
Ga0209350_108622723300026277Grasslands SoilRLREVGFDRAKTDFVAQEVAAMSITVPCKVSAEDVRTLLAAAY
Ga0209801_132012213300026326SoilPIPQRLREVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAH
Ga0257159_109966323300026494SoilREVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAAAY
Ga0209808_111904813300026523SoilPIPQRLTEVGFDRAKTDFVAQEIAAMKILAPRKVLAEDVRTLLAAAA
Ga0209690_114901823300026524SoilREVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAH
Ga0208997_103391123300027181Forest SoilSDVGFDRGKTDFVAAEIAKLAIAVPRAVSANDVRTLLAAA
Ga0209466_103008823300027646Tropical Forest SoilLEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAGAY
Ga0209799_106544313300027654Tropical Forest SoilLSEVGFDRAKTDFVAQQIAAMKILAPREVSAEDVRTLLAAAY
Ga0209465_1044896423300027874Tropical Forest SoilGFDRAKTDFVAQEVAAMAISLPRKVSAEDVRTLLAAAY
Ga0137415_1144737713300028536Vadose Zone SoilLSDVGFDRAKTDFVAGEIAAMAINVPRRVSTDDVRALLQAAY
Ga0307315_1014038213300028721SoilGFDRAKVDFVAGEVAAMSISAPRKVSADDVRAVLAAAY
Ga0307495_1018346523300031199SoilKLSDVGFDRAKIDFVAGEIAAMAISVPRQVSADDVRALLRAAY
Ga0318538_1033968523300031546SoilLLEVGFDRAKTDFVAREVEAMTISVPRKVAAEDVRTLLAAAY
Ga0318560_1002860513300031682SoilRAKTDFVAQEIAAMAISVPRKVSADDVRALLAAAD
Ga0318501_1003997933300031736SoilREVGFDRAKTDFIAQEVAAMAISVPRKVAAEDVRTLLAAAY
Ga0306918_1059291523300031744SoilRGFPIPQRLREVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVGALLAAAY
Ga0318494_1041405513300031751SoilQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY
Ga0318526_1012322923300031769SoilQRLREVGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAVAY
Ga0318566_1005272843300031779SoilGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF
Ga0318550_1000045913300031797SoilLSQVGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF
Ga0318497_1066577913300031805SoilLGAIESDFAQEVAAMAITVPRKVSAEDVRALLAAAY
Ga0318499_1017932313300031832SoilVGFDRAKADFVAQEVEAMAISVPRKVSAEDVRALLAAAY
Ga0318527_1032125613300031859SoilGFDRAKTDFVAQEVAAMAISVPRKVSAEDVRTLLAVAY
Ga0318495_1023693323300031860SoilPQRLLEVGFDRAKTDFVAQEVAAMSISVPRKVAAEDVRTLLAAAY
Ga0306921_1112361513300031912SoilEVGFDRAKTDFVAQEIAAMAISLPRKVSAEDVRTLLAAAY
Ga0306921_1224869523300031912SoilPQRLLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW
Ga0310912_1088312513300031941SoilQRLREVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVGALLAAAY
Ga0310916_1139732723300031942SoilGFPIPQRLLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW
Ga0310916_1157324923300031942SoilGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAY
Ga0306926_1147355113300031954SoilLEVGFDRAKTDFVAREVEAMAISVPRKVAAEDVRTLLAAAY
Ga0318531_1023559713300031981SoilQRLREVGFDRAKTDFVAQEVAAMAISIPRKVSAEDVRTLLAAAY
Ga0318531_1054374423300031981SoilLEVGFDRAKTDFVAREVEAMAIRVPRKVSAEDVHTLVAAAW
Ga0318563_1003297213300032009SoilFPIPQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY
Ga0318563_1078486913300032009SoilEVGFDRAKTDFIAQEVAEMAISVPRKVAAEDVRTLLAAAY
Ga0318569_1041923713300032010SoilVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVRALLAAAY
Ga0318532_1022516523300032051SoilGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY
Ga0318505_1001879143300032060SoilLPIPHRLSQVGFDDSKTDFVAQEVAALSISAPRPVSAADVRTLLAAAF
Ga0306924_1078682013300032076SoilPQRLREVGFDRAKTDFVAQEVAAMAITVPRKVSAEDVRALLAAAY
Ga0307471_10233465613300032180Hardwood Forest SoilDRAKIDFVAGEIAAMAISVPRKVSADDVRALLQAAY
Ga0307472_10277873623300032205Hardwood Forest SoilFDRGKIEFVAGEVAGMGITVPRAVSGADVRALLAAAY
Ga0306920_10211316413300032261SoilPQRLLEVGFDRAKTDFVAQEVAAMSITVPRKVSAEDVRALLAAAY
Ga0306920_10369471023300032261SoilIPQKLSDVGFDPARIDFVAGEVAAMAINSPRKVSAADVRALLQSAC
Ga0335081_1107421023300032892SoilAIAAMLQKFPIPERLGEIGFATGKIDFVAGEVAAQSIASPRQVTAEDVRELLRAAY
Ga0247829_1095495913300033550SoilAEVGFDRAKVDFVSGEVAAMSISAPRKASADDVRAVLAAAY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.