NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069069

Metagenome / Metatranscriptome Family F069069

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069069
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 41 residues
Representative Sequence SPRITRFWCAPDRGYIPMRVQQKKDDDVQWTLEIQSLKRE
Number of Associated Samples 115
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 89.52 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.935 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.710 % of family members)
Environment Ontology (ENVO) Unclassified
(21.774 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.355 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.41%    β-sheet: 35.29%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00692dUTPase 39.52
PF06559DCD 25.81
PF10609ParA 6.45
PF14890Intein_splicing 3.23
PF01850PIN 1.61
PF13614AAA_31 0.81
PF07992Pyr_redox_2 0.81
PF00437T2SSE 0.81
PF04014MazE_antitoxin 0.81
PF01979Amidohydro_1 0.81
PF00583Acetyltransf_1 0.81
PF13450NAD_binding_8 0.81
PF11769DUF3313 0.81
PF12840HTH_20 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 65.32
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 39.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.94 %
UnclassifiedrootN/A33.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459012|GOYVCMS02I0B1IAll Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300003505|JGIcombinedJ51221_10411040All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300005093|Ga0062594_101637570All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales669Open in IMG/M
3300005175|Ga0066673_10020939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3011Open in IMG/M
3300005341|Ga0070691_10238855All Organisms → cellular organisms → Bacteria → Proteobacteria970Open in IMG/M
3300005363|Ga0008090_10029946All Organisms → cellular organisms → Bacteria → Proteobacteria1054Open in IMG/M
3300005434|Ga0070709_10113295All Organisms → cellular organisms → Bacteria → Proteobacteria1826Open in IMG/M
3300005455|Ga0070663_100033879All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3532Open in IMG/M
3300005541|Ga0070733_10355064All Organisms → cellular organisms → Bacteria → Proteobacteria972Open in IMG/M
3300005541|Ga0070733_10562430All Organisms → cellular organisms → Bacteria → Proteobacteria764Open in IMG/M
3300005541|Ga0070733_10789173All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005577|Ga0068857_101130054All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300005993|Ga0080027_10085078All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1174Open in IMG/M
3300006050|Ga0075028_100347468All Organisms → cellular organisms → Bacteria → Proteobacteria837Open in IMG/M
3300006176|Ga0070765_102084132All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300006237|Ga0097621_100334638All Organisms → cellular organisms → Bacteria → Proteobacteria1343Open in IMG/M
3300006354|Ga0075021_10354231All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300006791|Ga0066653_10137767All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1170Open in IMG/M
3300009038|Ga0099829_11563702All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae544Open in IMG/M
3300009088|Ga0099830_11455043Not Available570Open in IMG/M
3300009093|Ga0105240_10707821All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1099Open in IMG/M
3300010049|Ga0123356_10262016All Organisms → cellular organisms → Bacteria → Proteobacteria1813Open in IMG/M
3300010049|Ga0123356_10410938Not Available1493Open in IMG/M
3300010361|Ga0126378_12471203Not Available593Open in IMG/M
3300010371|Ga0134125_10747013All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti1077Open in IMG/M
3300010376|Ga0126381_100723251All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1425Open in IMG/M
3300010376|Ga0126381_100833491All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300010379|Ga0136449_103546659Not Available593Open in IMG/M
3300011119|Ga0105246_12420095Not Available515Open in IMG/M
3300011120|Ga0150983_10790413All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Candidatus Thiosymbion → Candidatus Thiosymbion oneisti1039Open in IMG/M
3300012205|Ga0137362_11577906Not Available543Open in IMG/M
3300012206|Ga0137380_11703238All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300012210|Ga0137378_10329580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1419Open in IMG/M
3300012469|Ga0150984_117156907Not Available1323Open in IMG/M
3300012977|Ga0134087_10408196Not Available663Open in IMG/M
3300013307|Ga0157372_10965194Not Available988Open in IMG/M
3300014155|Ga0181524_10511080Not Available509Open in IMG/M
3300014158|Ga0181521_10407495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → environmental samples → uncultured Sphingomonadaceae bacterium668Open in IMG/M
3300014165|Ga0181523_10390281All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiolinaceae → Thiolinea → Thiolinea disciformis776Open in IMG/M
3300014325|Ga0163163_12108466Not Available623Open in IMG/M
3300014499|Ga0182012_10192308All Organisms → cellular organisms → Bacteria → Proteobacteria1437Open in IMG/M
3300014501|Ga0182024_12173228Not Available608Open in IMG/M
3300014654|Ga0181525_10045667Not Available2523Open in IMG/M
3300015051|Ga0137414_1063997All Organisms → cellular organisms → Bacteria → Proteobacteria1202Open in IMG/M
3300015052|Ga0137411_1171455All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1361Open in IMG/M
3300015054|Ga0137420_1494741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales2962Open in IMG/M
3300016357|Ga0182032_10286139All Organisms → cellular organisms → Bacteria → Proteobacteria1296Open in IMG/M
3300016387|Ga0182040_10571717Not Available912Open in IMG/M
3300017937|Ga0187809_10265418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria624Open in IMG/M
3300017966|Ga0187776_10312183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF0011026Open in IMG/M
3300017972|Ga0187781_10261255All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300017974|Ga0187777_10361184All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1000Open in IMG/M
3300017975|Ga0187782_10931843Not Available674Open in IMG/M
3300018007|Ga0187805_10436251Not Available610Open in IMG/M
3300018008|Ga0187888_1285557All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiolinaceae → Thiolinea → Thiolinea disciformis637Open in IMG/M
3300018058|Ga0187766_10398118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria910Open in IMG/M
3300018482|Ga0066669_10753086All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter tundripaludum860Open in IMG/M
3300020582|Ga0210395_11190022All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria560Open in IMG/M
3300020583|Ga0210401_10124370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2418Open in IMG/M
3300021180|Ga0210396_10875099All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria767Open in IMG/M
3300021358|Ga0213873_10147845All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria706Open in IMG/M
3300021420|Ga0210394_10646661All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae928Open in IMG/M
3300021477|Ga0210398_10472049All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300021478|Ga0210402_10430185All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae1226Open in IMG/M
3300022515|Ga0224546_1030506Not Available522Open in IMG/M
3300023268|Ga0247765_1099044Not Available616Open in IMG/M
3300024290|Ga0247667_1066495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria665Open in IMG/M
3300024295|Ga0224556_1015737All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1935Open in IMG/M
3300025505|Ga0207929_1106786All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025898|Ga0207692_10576108Not Available721Open in IMG/M
3300025913|Ga0207695_10524344Not Available1066Open in IMG/M
3300025914|Ga0207671_10753354Not Available773Open in IMG/M
3300025915|Ga0207693_10650301Not Available819Open in IMG/M
3300025926|Ga0207659_11760436Not Available527Open in IMG/M
3300025941|Ga0207711_11203597Not Available699Open in IMG/M
3300025986|Ga0207658_10973758Not Available773Open in IMG/M
3300026078|Ga0207702_10417330Not Available1297Open in IMG/M
3300026078|Ga0207702_10480711Not Available1209Open in IMG/M
3300026305|Ga0209688_1117646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → unclassified Chromatiaceae → Chromatiaceae bacterium505Open in IMG/M
3300026959|Ga0207852_1034030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria520Open in IMG/M
3300026959|Ga0207852_1036338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria502Open in IMG/M
3300027167|Ga0208096_103766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria754Open in IMG/M
3300027297|Ga0208241_1072106Not Available553Open in IMG/M
3300027548|Ga0209523_1046850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria882Open in IMG/M
3300027853|Ga0209274_10519781All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria616Open in IMG/M
3300027867|Ga0209167_10027914All Organisms → cellular organisms → Bacteria → Proteobacteria2703Open in IMG/M
3300027894|Ga0209068_10428983All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001756Open in IMG/M
3300028047|Ga0209526_10307127All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300028047|Ga0209526_10454982All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001841Open in IMG/M
3300028047|Ga0209526_10710282Not Available632Open in IMG/M
3300028558|Ga0265326_10031464All Organisms → cellular organisms → Bacteria → Proteobacteria1512Open in IMG/M
3300028792|Ga0307504_10351845All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria568Open in IMG/M
3300028800|Ga0265338_11007269Not Available564Open in IMG/M
3300028906|Ga0308309_11622598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria550Open in IMG/M
3300029951|Ga0311371_10463382All Organisms → cellular organisms → Bacteria → Proteobacteria1690Open in IMG/M
3300030053|Ga0302177_10184404All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1158Open in IMG/M
3300030490|Ga0302184_10030323All Organisms → cellular organisms → Bacteria → Proteobacteria2803Open in IMG/M
3300031028|Ga0302180_10240389Not Available956Open in IMG/M
3300031057|Ga0170834_107406538All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria828Open in IMG/M
3300031090|Ga0265760_10138631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. OF001791Open in IMG/M
3300031231|Ga0170824_103927780Not Available846Open in IMG/M
3300031234|Ga0302325_12129832All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria686Open in IMG/M
3300031236|Ga0302324_101428719All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300031469|Ga0170819_17894371Not Available637Open in IMG/M
3300031543|Ga0318516_10052110All Organisms → cellular organisms → Bacteria → Proteobacteria2228Open in IMG/M
3300031573|Ga0310915_11085277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria556Open in IMG/M
3300031708|Ga0310686_112084147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1188Open in IMG/M
3300031736|Ga0318501_10350290Not Available793Open in IMG/M
3300031736|Ga0318501_10382537Not Available759Open in IMG/M
3300031744|Ga0306918_10075883All Organisms → cellular organisms → Bacteria → Proteobacteria2324Open in IMG/M
3300031753|Ga0307477_10303656All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1101Open in IMG/M
3300031754|Ga0307475_11530015All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300031777|Ga0318543_10174181All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300031799|Ga0318565_10026982All Organisms → cellular organisms → Bacteria → Proteobacteria2573Open in IMG/M
3300031819|Ga0318568_10069173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2070Open in IMG/M
3300031945|Ga0310913_11126181Not Available548Open in IMG/M
3300031954|Ga0306926_12293799All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → unclassified Ectothiorhodospiraceae → Ectothiorhodospiraceae bacterium WFHF3C12598Open in IMG/M
3300031959|Ga0318530_10049365All Organisms → cellular organisms → Bacteria → Proteobacteria1579Open in IMG/M
3300031962|Ga0307479_10760502Not Available946Open in IMG/M
3300032039|Ga0318559_10318880Not Available722Open in IMG/M
3300032205|Ga0307472_101369089Not Available685Open in IMG/M
3300032770|Ga0335085_10834087Not Available1011Open in IMG/M
3300032895|Ga0335074_10174710Not Available2670Open in IMG/M
3300032955|Ga0335076_10014882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans7816Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.45%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.03%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.23%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.42%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.61%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.61%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.81%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.81%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.81%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022515Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027167Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N56_015750702170459012Grass SoilRITRFWCAPDRGYVPMRVEQKKGDDVQWTMEIKSFTRD
JGIcombinedJ51221_1041104023300003505Forest SoilSRRANSPRVNRYWCAPARGFVPLRAQQKKGDDVEWTMEIQSLTRD*
Ga0062594_10163757013300005093SoilYSPRVTRFWCAPDKGYVPMQVQQKKGNDVQWTLQIQSLTR*
Ga0066673_1002093963300005175SoilSPRVTRFWCAPWRGYVPLRVQQKRGDDIEWTMEIQSLTRE*
Ga0070691_1023885523300005341Corn, Switchgrass And Miscanthus RhizosphereIYGSQKEGSPRVTRFWCAPSHGFIPMKVEQKRKDEIEWTMLIESVERD*
Ga0008090_1002994633300005363Tropical Rainforest SoilSPRITRFWCAPDRGYIPMRVQQKKGEDVQWTLEIQSLKRE*
Ga0070709_1011329513300005434Corn, Switchgrass And Miscanthus RhizosphereYSPRTTRFWCAPGKGFIPMKVEQTKGDDVQWTLQIESLKR*
Ga0070663_10003387943300005455Corn RhizosphereGAQKVGSPRITRFWCAPSQGFVPMRVEQKKDDEVQWTMQLQSVKRDQS*
Ga0070733_1035506413300005541Surface SoilTRFWCAPSMGYLPLRIEQKRTDSVEWSMDIRSVRRD*
Ga0070733_1056243013300005541Surface SoilSPRITRFWCAPDRGYIPMKVEQKKGDDVQWTLQIQSLTRN*
Ga0070733_1078917323300005541Surface SoilRFWCAPARGYVPVRVQQKRLDSVEWTMEIETLQAD*
Ga0068857_10113005413300005577Corn RhizosphereGSQKEGSPRVTRFWCAPSRGFIPMKVEQKRKDEIEWTMLIESVERD*
Ga0080027_1008507823300005993Prmafrost SoilPRITRFWCAPERGYVPMRVEQKKGNDVQWTMEVKSFTRD*
Ga0075028_10034746823300006050WatershedsAYSPRVNRYWCAPDRGYVPLRVQQKRGDEVEWTMEIQSLKRE*
Ga0070765_10208413213300006176SoilANSPRVNSYWCAPDHGYIPLRVQQKRANDVEWTMEIQSLKRE*
Ga0097621_10033463813300006237Miscanthus RhizosphereFWCAPSRGYIPMRVEQKKDDDVQWTMQLQSVTRG*
Ga0075021_1035423133300006354WatershedsRITRFWCAPSLGFIPLRVEQKKAEDVQWAMQVQTVKR*
Ga0066653_1013776713300006791SoilIIYRSERENSPRVTRFWCAPWRGYVPLRVQQKRGDDIEWTMEIQSLTRE*
Ga0099829_1156370213300009038Vadose Zone SoilVTRFWCAPWRGDVPMRVEQKRGDDIEWTMEIRSLSRE*
Ga0099830_1145504313300009088Vadose Zone SoilSEREGSPRVTRFWCAPSRGYVPMRVEQKRGDDIEWTMEIRSLSRE*
Ga0105240_1070782123300009093Corn RhizosphereSPRVTRFWCAPSLGYIPLRVEQKKGKDDIEWTMQVQSVKREP*
Ga0123356_1026201613300010049Termite GutRFWCAPDRGFIPLRVQQKRGDEVQWTLEIQSLNRP*
Ga0123356_1041093823300010049Termite GutYSPRTTRFWCAPERGYIPVRVEQTKDQSVEWTMQIQSLKRD*
Ga0126378_1247120323300010361Tropical Forest SoilRITRFWCAPGRGYVPLKVEQTRGDEVQWTMEIQSLTRAP*
Ga0134125_1074701313300010371Terrestrial SoilRVTRFWCAPSRGYIPMRVEQKKDDDVQWTMQMQSVTRE*
Ga0126381_10072325113300010376Tropical Forest SoilSPRVTRFWCAPARGYIPLKVEQTRGDDVQWTMEIERLTRE*
Ga0126381_10083349123300010376Tropical Forest SoilVNRYWLAPDRGYIPMRVQQKRGDDVQWTMEIRSLKRQ*
Ga0136449_10354665913300010379Peatlands SoilPGSPRITRFWCAPDRGYIPLKVEQTRGDEVQWTLEIESLSRP*
Ga0105246_1242009523300011119Miscanthus RhizosphereRVTRFWCAPDKGYVPMQVQQKKGNDVQWTLQIQSLTR*
Ga0150983_1079041323300011120Forest SoilAGSPRITRFWCAPDRGYIPLKVEQTRGDEVQWTLEIESLSRP*
Ga0137362_1157790623300012205Vadose Zone SoilVIYRSEREGSPRVTRFWCAPWRGYVPMRVEQKRGDDIEWTMEIRSLSRE*
Ga0137380_1170323823300012206Vadose Zone SoilGSPRVTRFWCAPSRGYIPMRVEQKKDDEVQWAMQVETVKRD*
Ga0137378_1032958013300012210Vadose Zone SoilRVTRFWCAPSRGYIPLRVEQKKGDEVQWAMQVQSAKRD*
Ga0150984_11715690723300012469Avena Fatua RhizosphereRFWCAPSRGYIPMRVEQKKDDEVQWTMQLQSVTRE*
Ga0134087_1040819623300012977Grasslands SoilVTRFWCAPSRGYIPMRVEQKKGDDVQWTMQLQSVTRE*
Ga0157372_1096519413300013307Corn RhizosphereRFWCAPALGYIPMRVQQKRKDDVEWTMEVQSVKRD*
Ga0181524_1051108023300014155BogTRFWCAPSEGYLPMRVEQKRIDSVEWTMEIRSLKRG*
Ga0181521_1040749523300014158BogQHPGSPRITRFWCAPSKGYVPMRVQQKRIDSVEWTMEIETLKSQ*
Ga0181523_1039028113300014165BogQHEGSPRVTRFWCAPSEGYLPMRVEQKRIDSVEWTMEIRSLKRG*
Ga0163163_1210846613300014325Switchgrass RhizosphereQYSPRVTRFWCAPSLGYIPLRVEQKRKDDVEWTMQVQSVKREP*
Ga0182012_1019230833300014499BogHPGSPRVTRFWCAPSRGYLPMRVEQKRINSVEWTMDIRSLQRD*
Ga0182024_1217322823300014501PermafrostRSEKQNSPRTTRFWCAPSLGYIPLRVEQKRKDDVEWTMQVQSVKRE*
Ga0181525_1004566713300014654BogRVTRFWCAPSKGFVPVRVQQKRIDSVEWAMEIESLEAP*
Ga0137414_106399733300015051Vadose Zone SoilSSQKEGSPRVTQFWCAPSLGYIPLRVQQRRDHQIEWTMQIQSLKRD*
Ga0137411_117145533300015052Vadose Zone SoilEGSPRVTRFWCAPWRGHVPMRVEQKRGDEIEWTMEIRSLSRE*
Ga0137420_149474183300015054Vadose Zone SoilPRVTRFWCAPWRGYVPMRVEQKRGDEIEWTMEIRSLSRE*
Ga0182032_1028613913300016357SoilKKNSPRITRFWCAPDRGYIPLRVQQKKDDDVQWTLEIQSLKRQ
Ga0182040_1057171713300016387SoilPRVTRFWCAPDRGFIPMKVQQTKDGDVQWTMEIQSLRR
Ga0187809_1026541813300017937Freshwater SedimentPRITRFWCAPERGYIPMKVEQKKDDDVQWTLEIQSLKRQ
Ga0187776_1031218333300017966Tropical PeatlandNSPHVNRYWCAPDRGYIPVRVQQKRGDDVQWTMEIESLRRE
Ga0187781_1026125543300017972Tropical PeatlandSPRINSYWCAPLQGYIPVRVQQKRGDDVEWTMEIQSLKRE
Ga0187777_1036118433300017974Tropical PeatlandAQKAGSPRITRFWCAPERGYVPMKVEQTRGDEVQWTMEIESLTRAP
Ga0187782_1093184313300017975Tropical PeatlandRPGSQRANRYWCAPDRGYIPLRAEQKVDDDIQWTMNIESLKRD
Ga0187805_1043625113300018007Freshwater SedimentTRFWCAPERGYIPLKVEQTRGDDVQWTMEIESLTR
Ga0187888_128555713300018008PeatlandRVTRFWCAPSEGYLPMRVEQKRIDSVEWTMEIRSLKRG
Ga0187766_1039811823300018058Tropical PeatlandNRYWCAPDRGYIPLRVQQKRGDEVQWTMEIRTLKRE
Ga0066669_1075308633300018482Grasslands SoilSPRVTRFWCAPWRGYVPLRVQQKRGDDIEWTMEIQSLTRE
Ga0210395_1119002213300020582SoilTSRKANSPRVNSYWCAPDQGYIPLRVQQKRADEVEWTMEILSLKRE
Ga0210401_1012437033300020583SoilQKTYSPRITRFWCAPDRGYIPMKVEQKKGDDVQWTLQIQGLTRN
Ga0210396_1087509923300021180SoilRKNSPHVNRYWCAPERGYIPMRVEQKRGDEVQWAMEIQSLKRQ
Ga0213873_1014784513300021358RhizosphereRATRFWCAPERGYVPVKVEQAIGQDVQWTLLIQSLKR
Ga0210394_1064666123300021420SoilEGSPRVTRFWCAPDRGYIPMRVEQTRDKDVEWTMQIRSLKRE
Ga0210398_1047204913300021477SoilRVTRFWCSPERGYVPIKVEQTKGSDVQWTLEIQSLTR
Ga0210402_1043018513300021478SoilNSPRATRFWCAPSRGYIPLKVEQKRGDDVEWAMEITSLKRE
Ga0224546_103050613300022515SoilVVYTSQKANSPRVNSYWCAPDRGYIPMRVQQKRGEEVEWTMEIESVKRQ
Ga0247765_109904413300023268Plant LitterRVTRFWCAPSRGFIPMRVEQKKGGDVQWTMQLQAVTRE
Ga0247667_106649513300024290SoilYRAQKKYSPRTTRFWCAPDKGFIPMKVEQTKGDEVQWTLQIESLKR
Ga0224556_101573713300024295SoilPRITRFWCAPEHGYVPLKVEQRIGEDVQWSMEIMSLTGG
Ga0207929_110678623300025505Arctic Peat SoilRVTRFWCAPSRGYVPVRVEQKRIDSVEWTLEIQTLAGD
Ga0207692_1057610823300025898Corn, Switchgrass And Miscanthus RhizosphereYSPRVTRFWCAPDKGYVPMQVQQKKGNDVQWTLQIQSLTR
Ga0207695_1052434423300025913Corn RhizosphereSPRVTRFWCAPSLGYIPLRVEQKKGKDDIEWTMQVQSVKREP
Ga0207671_1075335423300025914Corn RhizosphereFKSEKQYSPRVTRFWCAPSLGYIPLRVEQKKGKDDIEWTMQVQSVKREP
Ga0207693_1065030123300025915Corn, Switchgrass And Miscanthus RhizosphereQKKYSPRITSFWCAPDRGYIPMKVQQKKGEDVQWTLEIQSLTRQ
Ga0207659_1176043613300025926Miscanthus RhizosphereRSEKQYSPRVTRFWCAPSLGYIPLRVQQKRKDDVEWTMQVQSVKREQ
Ga0207711_1120359723300025941Switchgrass RhizospherePRVTRFWCAPSRGFIPMRVEQKKDDEVQWTMQVQSVTRG
Ga0207658_1097375823300025986Switchgrass RhizosphereRVTRFWCAPSRGYIPVRIEQTKGDDVQWTMQVQSVKRD
Ga0207702_1041733013300026078Corn RhizosphereRFWCAPSRGYIPMRVEQKKDDDVQWTMQVQSVTRG
Ga0207702_1048071123300026078Corn RhizosphereTPIGSIATIVYASQKEGSPRVTRFWCAPARGFIPMKVEQKRKDEVEWTLLIESVQRE
Ga0209688_111764623300026305SoilSPRVTRFWCAPWRGYVPLRVQQKRGEDVEWTMEIQSLTRE
Ga0207852_103403023300026959Tropical Forest SoilKAHSPRITRFWCAPDRGYVPMKVEQTKGDDVQWTMEIRSLKRQ
Ga0207852_103633823300026959Tropical Forest SoilSQRPNSARINRYWCAPERGQIPMRVQQKVDDDVQWTMEIRSFKRE
Ga0208096_10376623300027167Forest SoilYSSQKAYSPRINSYWCAPDRGYIPMRVQQKRGDDVEWTMEIQSLKRE
Ga0208241_107210613300027297Forest SoilPRITRFWCAPDRGYIPMKVEQKKGDDVQWTLQIQSVTRN
Ga0209523_104685033300027548Forest SoilTVVYRAQKAGSPRVTRFWCAPERGYIPLRVEQTRGDDVQWTMEIQSLRRE
Ga0209274_1051978113300027853SoilANSPRVNSYWCAPEQGYLPLRVQQKRADEVEWTMEILSLKRE
Ga0209167_1002791443300027867Surface SoilFQSHKQGSPRVNLFWCAPARNYIPLRVEQRRKGEVQWTMQIESLTLGPG
Ga0209068_1042898323300027894WatershedsPRITRFWCAPSLGFIPLRVEQKKAEDVQWAMQVQTVKR
Ga0209526_1030712733300028047Forest SoilRFWCAPTKGYVPMRVQQKRIDSVEWTMEIESFKTD
Ga0209526_1045498213300028047Forest SoilRFWCAPARGYIPMRVEQKRGDDIEWSMEIRSLKRE
Ga0209526_1071028223300028047Forest SoilRFWCAPARGYIPMRVEQKRGDDIEWSMEIRSLSRE
Ga0265326_1003146433300028558RhizosphereRITRFWCAPARGYVPLKVEQRIGNDVQWSMEIMRLTGG
Ga0307504_1035184513300028792SoilPRVTRFWCAPWRGYVPMRVEQKRGDDIEWTMEIRSLSRE
Ga0265338_1100726913300028800RhizosphereRFWCAPAEGYIPMKVEQTKGDDVQWTLQIQSLKRD
Ga0308309_1162259813300028906SoilVNYTSRKANSPRVNSYWCAPDHGYIPLRVQQKRANEVEWTMEIQSLKRE
Ga0311371_1046338213300029951PalsaSEKQYSPRITRFWCAPSLGYIPLRVQQTRNDDVEWTMQVQSVKRE
Ga0302177_1018440413300030053PalsaAYSPRVTRFWCAPGNGYIPMKVEQTKGDDVQWTLQIQSLKRD
Ga0302184_1003032343300030490PalsaRFWCAPSKGFVPVRVQQKRIDSVEWAMEIQSLEAP
Ga0302180_1024038913300031028PalsaQKAYSPRVTRFWCAPGNGYIPMKVEQTKGDDVQWTLQIQSLKRD
Ga0170834_10740653823300031057Forest SoilVYRAQKANSPRITRFWCAPGRGYIPLKVEQTKGDDVQWTMEIQSLERH
Ga0265760_1013863113300031090SoilRKANSPRVNSYWCAPEQGYLPLRVQQKRADEVEWTMEILSLKRE
Ga0170824_10392778013300031231Forest SoilRTTRFWCAPSLGYIPLRVQQTRKDDVEWTMQVKSVKREQ
Ga0302325_1212983213300031234PalsaSQRANSPRFNRYWCAPDRGYIPMRVQQKRGDEVQWTMEIESVKRQ
Ga0302324_10142871913300031236PalsaRFWCAPSKGYVPLRVEQKRLDEVEWTMEIETLKAQ
Ga0170819_1789437113300031469Forest SoilRSQKTGSPRVTRFWCAPSRGYIPMRVEQKKGDDVQWTMQVQSVKRD
Ga0318516_1005211043300031543SoilKKNSPRITRFWCAPDRGYVPMRVQQKKDEDVQWTLEIQSLKRE
Ga0310915_1108527713300031573SoilKSQKKYSPRITRFWCAPDRGYVPMRVQQKKDDDVQWTLEIQSLKRE
Ga0310686_11208414713300031708SoilREGSPRVTRFWCAPDRGYIPMRVEQTRGKDVEWTMEIRSLKRE
Ga0318501_1035029013300031736SoilRFWCAPDRGYIPLRVQQKKDDDVQWTLEIQSLKRQ
Ga0318501_1038253713300031736SoilSPRITRFWCAPDRGYIPMRVQQKKDDDVQWTLEIQSLKRE
Ga0306918_1007588313300031744SoilSPRITRFWCAPDRGYVPMRVQQRKGDDVQWTLEIQSLKRE
Ga0307477_1030365613300031753Hardwood Forest SoilRENSPRVTRFWCAPWRGYVPLRVEQKRGDEIEWTMEIKSLSRE
Ga0307475_1153001523300031754Hardwood Forest SoilGAIATVVYRAQKAGSPRVTRFWCAPERGYIPLRVEQTRGDDVQWSMEIERLRRE
Ga0318543_1017418113300031777SoilKYSPRITRFWCAPDRGYVPMRVQQKRDEDVQWTLEIASLTRR
Ga0318565_1002698213300031799SoilNSPRITRFWCAPDRGYVPMRVQQKKDEDVQWTLEIQSLKRE
Ga0318568_1006917343300031819SoilNSPRITRFWCAPDHGYIPMRVQQKKDDDVQWTLEIQSLQRQ
Ga0310913_1112618113300031945SoilIFSSQRVNSPHVNRYWLAPDRGYIPMRVQQKRDDDVQWTMEIQSLQR
Ga0306926_1229379913300031954SoilVATVVYTSQRAGSPRITRFWCAPDKGFIPLRVEQRRQNDVEWRMDIQSLNRP
Ga0318530_1004936533300031959SoilKNSPRITRFWCAPDRGYVPMRVQQKKDEDVQWTLEIQSLKRE
Ga0307479_1076050223300031962Hardwood Forest SoilTRFWCAPSLGYIPVRVEQTKGQRDVEWTMQVQSVKREP
Ga0318559_1031888023300032039SoilQKKYSPRITRFWCAPDRGYIPMRVQQKKDDDVQWTLEIQSLKRE
Ga0307472_10136908923300032205Hardwood Forest SoilTRFWCAPHQGYVPVKVEQTKGDEVQWTMEIRSLSRQ
Ga0335085_1083408723300032770SoilSPRITSFWCAPDRGYIPMKVQQKKGDDVQWTLEIQSLTRQ
Ga0335074_1017471043300032895SoilAHHTGSPRTTRFWCAPSLGYVPLRVQQKRLNEVEWTLQIRSLQRG
Ga0335076_1001488213300032955SoilITRFWCASDRGFIPVRVQQKRDDDVQWTLEIQSLSRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.