Basic Information | |
---|---|
Family ID | F069075 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 40 residues |
Representative Sequence | KSAEPAELLKRLMAELDLFVGNTPQHDDVTCMLLKSE |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.81 % |
% of genes near scaffold ends (potentially truncated) | 99.19 % |
% of genes from short scaffolds (< 2000 bps) | 85.48 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.581 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.097 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.258 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF00848 | Ring_hydroxyl_A | 27.42 |
PF07963 | N_methyl | 12.10 |
PF13432 | TPR_16 | 6.45 |
PF02954 | HTH_8 | 3.23 |
PF04794 | YdjC | 3.23 |
PF00999 | Na_H_Exchanger | 2.42 |
PF13544 | Obsolete Pfam Family | 2.42 |
PF04226 | Transgly_assoc | 1.61 |
PF00625 | Guanylate_kin | 1.61 |
PF00515 | TPR_1 | 1.61 |
PF14378 | PAP2_3 | 1.61 |
PF00072 | Response_reg | 0.81 |
PF07603 | DUF1566 | 0.81 |
PF03795 | YCII | 0.81 |
PF00682 | HMGL-like | 0.81 |
PF13602 | ADH_zinc_N_2 | 0.81 |
PF13620 | CarboxypepD_reg | 0.81 |
PF07610 | DUF1573 | 0.81 |
PF02366 | PMT | 0.81 |
PF01740 | STAS | 0.81 |
PF13581 | HATPase_c_2 | 0.81 |
PF00355 | Rieske | 0.81 |
PF03372 | Exo_endo_phos | 0.81 |
PF01551 | Peptidase_M23 | 0.81 |
PF01261 | AP_endonuc_2 | 0.81 |
PF13181 | TPR_8 | 0.81 |
PF02518 | HATPase_c | 0.81 |
PF00069 | Pkinase | 0.81 |
PF00450 | Peptidase_S10 | 0.81 |
PF03625 | DUF302 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 54.84 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 3.23 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.42 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.42 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.42 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.42 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.42 |
COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 1.61 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.61 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 0.81 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.58 % |
Unclassified | root | N/A | 2.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10062805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1902 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1010978 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300001087|JGI12677J13195_1009967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 670 | Open in IMG/M |
3300001356|JGI12269J14319_10199378 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300001471|JGI12712J15308_10096201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
3300001593|JGI12635J15846_10655044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100934039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 750 | Open in IMG/M |
3300002914|JGI25617J43924_10222782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 631 | Open in IMG/M |
3300005162|Ga0066814_10116210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300005178|Ga0066688_10408583 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300005437|Ga0070710_11070759 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005587|Ga0066654_10170130 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300005952|Ga0080026_10002667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4237 | Open in IMG/M |
3300006028|Ga0070717_10105097 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
3300006162|Ga0075030_100618772 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300006176|Ga0070765_101819624 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006804|Ga0079221_10754864 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300006893|Ga0073928_10632021 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300007258|Ga0099793_10246560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300007788|Ga0099795_10542959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300009088|Ga0099830_10508496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300009143|Ga0099792_10500191 | Not Available | 761 | Open in IMG/M |
3300009524|Ga0116225_1185419 | Not Available | 943 | Open in IMG/M |
3300009525|Ga0116220_10567123 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300009630|Ga0116114_1088069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 836 | Open in IMG/M |
3300009630|Ga0116114_1197775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009632|Ga0116102_1029992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1820 | Open in IMG/M |
3300009633|Ga0116129_1012261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3261 | Open in IMG/M |
3300009645|Ga0116106_1196027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 643 | Open in IMG/M |
3300009700|Ga0116217_10232084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1203 | Open in IMG/M |
3300009839|Ga0116223_10679532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300010366|Ga0126379_13044138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300010371|Ga0134125_10173856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2400 | Open in IMG/M |
3300010376|Ga0126381_102134380 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300010398|Ga0126383_10765022 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300010398|Ga0126383_12046878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300011269|Ga0137392_10230939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1520 | Open in IMG/M |
3300012211|Ga0137377_11473604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300012350|Ga0137372_11064433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300012918|Ga0137396_11190509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300012924|Ga0137413_11209188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300014169|Ga0181531_10117788 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300015195|Ga0167658_1116851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300015242|Ga0137412_10510496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
3300015264|Ga0137403_11060562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300015374|Ga0132255_100669800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1539 | Open in IMG/M |
3300015374|Ga0132255_103544047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300016319|Ga0182033_11035408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300016341|Ga0182035_10734865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300016702|Ga0181511_1007453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300017823|Ga0187818_10114121 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300017931|Ga0187877_1145858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
3300017955|Ga0187817_10021839 | All Organisms → cellular organisms → Bacteria | 3811 | Open in IMG/M |
3300017955|Ga0187817_10227230 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300017955|Ga0187817_10228443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
3300017966|Ga0187776_10921380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300018009|Ga0187884_10067612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1620 | Open in IMG/M |
3300018012|Ga0187810_10057112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1480 | Open in IMG/M |
3300018030|Ga0187869_10412520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300018057|Ga0187858_10074950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2353 | Open in IMG/M |
3300018085|Ga0187772_10488236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
3300018085|Ga0187772_10929953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300018086|Ga0187769_10639919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300018088|Ga0187771_10010995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6562 | Open in IMG/M |
3300018088|Ga0187771_10018799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5121 | Open in IMG/M |
3300020199|Ga0179592_10327108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300020579|Ga0210407_11224957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300020580|Ga0210403_11301087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300021181|Ga0210388_10606877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
3300021401|Ga0210393_10095890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2359 | Open in IMG/M |
3300021402|Ga0210385_10687978 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300021403|Ga0210397_10604246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300021433|Ga0210391_10392522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
3300021474|Ga0210390_10897685 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300021475|Ga0210392_10772252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300021475|Ga0210392_11318668 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300023012|Ga0228597_103265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
3300024295|Ga0224556_1125389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300025412|Ga0208194_1062664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300025915|Ga0207693_10810816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300025949|Ga0207667_10335625 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300026333|Ga0209158_1039008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2007 | Open in IMG/M |
3300026508|Ga0257161_1077784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300026557|Ga0179587_11069263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300027030|Ga0208240_1014867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300027439|Ga0209332_1039724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300027439|Ga0209332_1090764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300027568|Ga0208042_1058541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300027576|Ga0209003_1081701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300027604|Ga0208324_1000580 | All Organisms → cellular organisms → Bacteria | 16384 | Open in IMG/M |
3300027625|Ga0208044_1093105 | Not Available | 887 | Open in IMG/M |
3300027681|Ga0208991_1181039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300027745|Ga0209908_10126313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300027821|Ga0209811_10077889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1167 | Open in IMG/M |
3300027867|Ga0209167_10624774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300027869|Ga0209579_10425086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 720 | Open in IMG/M |
3300027882|Ga0209590_10252057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
3300027895|Ga0209624_10028252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3564 | Open in IMG/M |
3300027905|Ga0209415_10360487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1203 | Open in IMG/M |
3300027908|Ga0209006_10076224 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
3300027908|Ga0209006_10751903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300027986|Ga0209168_10343049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300028017|Ga0265356_1014214 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300028047|Ga0209526_10164706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
3300028536|Ga0137415_10111515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2583 | Open in IMG/M |
3300028608|Ga0247819_10771838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300028863|Ga0302218_10203716 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300028879|Ga0302229_10495439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300028909|Ga0302200_10189866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
3300029915|Ga0311358_10995226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300029918|Ga0302143_1102416 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300030659|Ga0316363_10075184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
3300031028|Ga0302180_10051998 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
3300031718|Ga0307474_10096067 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
3300031753|Ga0307477_10783503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300031754|Ga0307475_11071614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300031754|Ga0307475_11484270 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031823|Ga0307478_11162212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300031823|Ga0307478_11812543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300032160|Ga0311301_10502623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1796 | Open in IMG/M |
3300032783|Ga0335079_10492362 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300032805|Ga0335078_10174042 | All Organisms → cellular organisms → Bacteria | 3019 | Open in IMG/M |
3300032805|Ga0335078_11663691 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032954|Ga0335083_10075981 | All Organisms → cellular organisms → Bacteria | 3406 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.48% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.87% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.81% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100628051 | 3300000567 | Peatlands Soil | GKSVEPTDMLKRLMAEVDLFVGNTPQHDDVTCMLLKSESF* |
AP72_2010_repI_A01DRAFT_10109781 | 3300000579 | Forest Soil | LPPADMLKRLMSELDLFVGTTPQHDDVTCMLLKSE* |
JGI12677J13195_10099671 | 3300001087 | Forest Soil | GAAATPAEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE* |
JGI12269J14319_101993782 | 3300001356 | Peatlands Soil | AIAAGAATTPSDMLKRLMAEVDLFVGSTPQHDDVTCLLVKAESS* |
JGI12712J15308_100962011 | 3300001471 | Forest Soil | PSDMLKRLMADLDLFVGSTPQHDDVTCLLLKAENF* |
JGI12635J15846_106550444 | 3300001593 | Forest Soil | GAAGTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVRAEIS* |
JGIcombinedJ26739_1009340391 | 3300002245 | Forest Soil | SDMLKRLMADLDLFVGSTPQHDDVTCLLLKAENF* |
JGI25617J43924_102227821 | 3300002914 | Grasslands Soil | AGASSTPKELLDRLMVSLDLFVGSTPQHDDVTCLLVKAGND* |
Ga0066814_101162101 | 3300005162 | Soil | GKSVEPTDMLKRLMAEVDLFVGNTPQHDDVTCLLLKSEELS* |
Ga0066688_104085831 | 3300005178 | Soil | QAGAATEPADLLQRLMAELDLFVGSTPQHDDVTCMLLKAGA* |
Ga0070710_110707591 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AIEAAKSFSPAELLKRLMTELDLFVGNTPQHDDVTCMLLKSE* |
Ga0066654_101701301 | 3300005587 | Soil | AKSFSPAELLKRLMTELDLFVGNTPQHDDVTCMLLKSE* |
Ga0080026_100026671 | 3300005952 | Permafrost Soil | LLSAIESGKLVEPAELLKHLMAEVDLFVGNTPQHDDVTCMLLKSESFE* |
Ga0070717_101050973 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QPNDLLKRLMSDLDVFVGNTPQHDDVTCMLLKSE* |
Ga0075030_1006187721 | 3300006162 | Watersheds | VRVLTELETGKSNTPAALLKQLMSALDLFVGNTPQHDDVTCMLLKAETL* |
Ga0070765_1018196241 | 3300006176 | Soil | LIGALEAGKSGTPQELLDRLMANLDLFVGSTPQHDDVTCLIVKAT* |
Ga0079221_107548642 | 3300006804 | Agricultural Soil | LLTTLEAGKSLQPNDLLKHLMSELDIFVGNTPQHDDVTCMLLKSE* |
Ga0073928_106320211 | 3300006893 | Iron-Sulfur Acid Spring | PAEMLKSLMAELDVFVGNTPQHDDVTCMLLKAGSF* |
Ga0099793_102465602 | 3300007258 | Vadose Zone Soil | LENAGSTSPQELLNRLMAGLDLFVGNTPQHDDVTCMLLKA* |
Ga0099795_105429592 | 3300007788 | Vadose Zone Soil | EAGKSTTPKELLDCLMRDLDLFVGSTPQHDDVTCLLVKAENV* |
Ga0099830_105084961 | 3300009088 | Vadose Zone Soil | SALEAGKSTSPKELLDRLMCDLDLFVGSTPQHDDVTCLLIKAENV* |
Ga0099792_105001912 | 3300009143 | Vadose Zone Soil | LLHAIEAGTSGRPSDMLKRLMAELDLFVGNTPQHDDVTCMLLKAEAC* |
Ga0116225_11854192 | 3300009524 | Peatlands Soil | GVIEAGKSAEPDELLKRLMAELDLFVGSTPQHDDVTCMLLKAESF* |
Ga0116220_105671231 | 3300009525 | Peatlands Soil | AAIEAGRASTPADMLKRLMAEVDLFVGNTPQHDDVTCMLVKSE* |
Ga0116114_10880692 | 3300009630 | Peatland | AAGTASTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVRAE* |
Ga0116114_11977752 | 3300009630 | Peatland | TPAEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE* |
Ga0116102_10299922 | 3300009632 | Peatland | STPAEMLNRLMAELDLFVGNTPQHDDVTCLLVKGE* |
Ga0116129_10122614 | 3300009633 | Peatland | AGAATAPADMLSRLMAELDLFVGSTPQHDDVTCLLVKAEH* |
Ga0116106_11960271 | 3300009645 | Peatland | KSDEPAAMLNRLMAELDLFVGSTPQHDDVTCMLLKAE* |
Ga0116217_102320841 | 3300009700 | Peatlands Soil | LAVLEGGKSGSPSDLLKLLMSDLDLFVGNTPQHDDVTCMLIKAEN* |
Ga0116223_106795321 | 3300009839 | Peatlands Soil | TPKESLDRLMAQLDLFVGSTPQHDDVTCMLLKVA* |
Ga0126379_130441381 | 3300010366 | Tropical Forest Soil | KLLPPGELLKRLMSDLDLFVGNTPQHDDVTCMLLKSE* |
Ga0134125_101738561 | 3300010371 | Terrestrial Soil | GTDTMPSELLHHMMADLDIFVGATPQHDDVTCMLIRVD* |
Ga0126381_1021343801 | 3300010376 | Tropical Forest Soil | RSTRASPAEMMHRVLADLELFVGNTPQHDDVTCLLLKAT* |
Ga0126383_107650222 | 3300010398 | Tropical Forest Soil | TPVEMMQRIFTALDVFVGNTPQHDDVTSLLVKVS* |
Ga0126383_120468782 | 3300010398 | Tropical Forest Soil | RLLSAIEACKLLPPSELLKRLMFELDVFVGNTPQHDDVTCMLLKSE* |
Ga0137392_102309391 | 3300011269 | Vadose Zone Soil | AKLLVLLENAGSTSPQELLNRLMAGLDLFVGNTPQHDDVTCMLLKA* |
Ga0137377_114736041 | 3300012211 | Vadose Zone Soil | GELLKRLIAELDLFVGNTPQHDDVTCMLLKAESL* |
Ga0137372_110644331 | 3300012350 | Vadose Zone Soil | GKLVEPADMLSRLMAEVDLFVGNTPQHDDVTCMLLKAESV* |
Ga0137396_111905092 | 3300012918 | Vadose Zone Soil | STSPQELLNRLMAGLDLFVGNTPQHDDVTCMLLKA* |
Ga0137413_112091881 | 3300012924 | Vadose Zone Soil | GVSSMPKELLDRLMASLDLFVGATPQHDDVTCLLVKAENL* |
Ga0181531_101177883 | 3300014169 | Bog | TAALTPSEMLKRLMTEVDQFVGQTPQHDDVTLMLLKAE* |
Ga0167658_11168511 | 3300015195 | Glacier Forefield Soil | KSEAPAGLLKRMMTELDAFVGATPQHDDVTCLLLKAENF* |
Ga0137412_105104961 | 3300015242 | Vadose Zone Soil | EEGVSSMPKELLDRLMASLDLFVGATPQHDDVTCLLVKAENL* |
Ga0137403_110605622 | 3300015264 | Vadose Zone Soil | VSSMPKELLDRLMARLDLFVGATPQHDDVTCLLVKAENL* |
Ga0132255_1006698001 | 3300015374 | Arabidopsis Rhizosphere | AGADTSSANMLSRTMADLDLFVGNTPQHADITCLLIKYG* |
Ga0132255_1035440471 | 3300015374 | Arabidopsis Rhizosphere | AGKSVEPNDMLKRLMAEVDLFVGNTPQHDDVTCLLLKSEEFS* |
Ga0182033_110354081 | 3300016319 | Soil | EARLLVAIENGKSVSPPDLLKRLMSELDVYVGTTPQHDDVTCMLLKAE |
Ga0182035_107348651 | 3300016341 | Soil | SKLQPPSELLKRLMFDLDVFVGNTPQHDDVTCMLLKAE |
Ga0181511_10074532 | 3300016702 | Peatland | AAGTASTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE |
Ga0187818_101141212 | 3300017823 | Freshwater Sediment | LTAIEAGKSVEPQEMLKRLMAEVDLFVGNTPQHDDVTCLLLKSESL |
Ga0187877_11458581 | 3300017931 | Peatland | LSAIAAGTASTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVRAE |
Ga0187817_100218391 | 3300017955 | Freshwater Sediment | KSAEPAELLKRLMAELDLFVGNTPQHDDVTCMLLKSE |
Ga0187817_102272301 | 3300017955 | Freshwater Sediment | AGKSFSPADLLKHLMSALDLFVGSTPQHDDVTCMLLKAESL |
Ga0187817_102284431 | 3300017955 | Freshwater Sediment | EAGKSEEPAAMLKRLMSELDLFVGNTPQHDDVTCMLLKAGNL |
Ga0187776_109213802 | 3300017966 | Tropical Peatland | ATSSEAAPQEMMRRILADLDAFVGNTPQHDDVTCLLLKAT |
Ga0187884_100676121 | 3300018009 | Peatland | SAIAAGTASTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVRAE |
Ga0187810_100571121 | 3300018012 | Freshwater Sediment | AWKSVEPAEMLKRFMAELDVFVGTTPQHDDVTCMLLKAENI |
Ga0187869_104125201 | 3300018030 | Peatland | IVAGAAGTPPEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE |
Ga0187858_100749501 | 3300018057 | Peatland | GTASTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVKGE |
Ga0187772_104882362 | 3300018085 | Tropical Peatland | VLGVIEAGKSDEPSAMLKRLMSALDLFVGNTPQHDDVTCMLLKAENA |
Ga0187772_109299532 | 3300018085 | Tropical Peatland | AAKSLEPADLLKRLMAELDLFVGSTPQHDDVTCMLLKAESV |
Ga0187769_106399191 | 3300018086 | Tropical Peatland | QVIESGRGGTPAEMLHRLMAALDLFVGSTPQHDDVTCMLLKAESA |
Ga0187771_100109951 | 3300018088 | Tropical Peatland | VLGVIEAGRSEEPSAMLKRLMSELDLFVGNTPQHDDVTCMLLKAEDS |
Ga0187771_100187996 | 3300018088 | Tropical Peatland | AQRAASGTGATPSELLKRMTADLDLFVGQTPQHDDVTCLLVKAGNG |
Ga0179592_103271082 | 3300020199 | Vadose Zone Soil | LENAGSTSPQELLNQLMAGLDLFVGNTPQHDDVTCMLLKA |
Ga0210407_112249571 | 3300020579 | Soil | KGTEPPEMLKRLMAEVDLFVGNTPQHDDVTCLLLKSETF |
Ga0210403_113010871 | 3300020580 | Soil | AGKGTEPPEMLKRLMAEVDLFVGNTPQHDDVTCLLLKSETF |
Ga0210388_106068772 | 3300021181 | Soil | GAAGTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVRAEIS |
Ga0210393_100958903 | 3300021401 | Soil | AAGAAGTPAEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE |
Ga0210385_106879781 | 3300021402 | Soil | TTPADMLKRLMADLDLFVGNTPQHDDVTCMLLKAENF |
Ga0210397_106042461 | 3300021403 | Soil | GKALPPNDLLKRLMSDLDVFVGNTPQHDDVTCMLLKSE |
Ga0210391_103925221 | 3300021433 | Soil | GTAPKELLERLMASLDLFVGSTPQHDDVTCLLVKSENI |
Ga0210390_108976851 | 3300021474 | Soil | AGKSVEPAEMLKRLMAEVDLFVGNTPQHDDVTCLLLKSESF |
Ga0210392_107722522 | 3300021475 | Soil | STPKELLDRLMADLDLFVGTTPQHDDVTCLLIKAESS |
Ga0210392_113186682 | 3300021475 | Soil | TVGANASLAPNDMLQRLMAELDLYVGTTPQHDDVTVMLIKAE |
Ga0228597_1032652 | 3300023012 | Plant Litter | AIEAGKSSEPADMLKRFMSELDLFVGNTPQHDDVTCLLLKAESF |
Ga0224556_11253892 | 3300024295 | Soil | IAAGAATTPPEMLNRLMAELDLFVGSTPQHDDVTCLLVKAE |
Ga0208194_10626641 | 3300025412 | Peatland | AAIVAGAAGTPPEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE |
Ga0207693_108108162 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SFSPAELLKRLMTELDLFVGNTPQHDDVTCMLLKSE |
Ga0207667_103356253 | 3300025949 | Corn Rhizosphere | KSFSPSELLKRLMTELDLFVGNTPQHDDVTCMLLKSE |
Ga0209158_10390082 | 3300026333 | Soil | TSGRPCDMLERLMAELDLFVGNTPQHDDVTCMLLKAEAC |
Ga0257161_10777842 | 3300026508 | Soil | SGRPSDMLKRLMAELDLFVGNTPQHDDVTCMLLKAETY |
Ga0179587_110692632 | 3300026557 | Vadose Zone Soil | EAGPSATPKELLDRLMVNLDLFVGSTPQHDDVTCLLVKAEDL |
Ga0208240_10148671 | 3300027030 | Forest Soil | PADMLKRLMADLDLFVGNTPQHDDVTCMLLKAESF |
Ga0209332_10397242 | 3300027439 | Forest Soil | LTAIEGSKTAEPSEMLKRLMAELDLFVGNTPQHDDVTCMLLKAEPLHA |
Ga0209332_10907642 | 3300027439 | Forest Soil | LESGKLVEPAELLKHLMAEVDLFVGNTPQHDDVTCMLLKSQSF |
Ga0208042_10585412 | 3300027568 | Peatlands Soil | WLSALEASVSATPKESLDRLMAQLDLFVGSTPQHDDVTCMLLKVA |
Ga0209003_10817012 | 3300027576 | Forest Soil | IEAARSGEPTDMLKRLMAELDLFVGNTAQHDDVTCMLLKACS |
Ga0208324_10005801 | 3300027604 | Peatlands Soil | HWPREWLSALEASVSATPKESLDRLMAQLDLFVGSTPQHDDVTCMLLKVA |
Ga0208044_10931051 | 3300027625 | Peatlands Soil | AEPDELLKRLMAELDLFVGSTPQHDDVTCMLLKAESF |
Ga0208991_11810392 | 3300027681 | Forest Soil | NASPLELLNRLMAGLDLFVGNTAQHDDVTCMLLKTELLPS |
Ga0209908_101263132 | 3300027745 | Thawing Permafrost | GAATAPAEMLNRLMAELDLFVGATPQHDDVTCLLVRAENF |
Ga0209811_100778891 | 3300027821 | Surface Soil | LPTIESGKALTPGDMLKRLMSELDLFVGTTPQHDDVTCMLLKSE |
Ga0209167_106247742 | 3300027867 | Surface Soil | GKSGEPSDMLKRLMADVDLFVGNTPQHDDVTCMLLKSE |
Ga0209579_104250861 | 3300027869 | Surface Soil | AGAAGTPAEMLNRLMAELDLFVGDTPQHDDITCLLVKAE |
Ga0209590_102520572 | 3300027882 | Vadose Zone Soil | DVEMLKRLMAEVDLFVGNTPQHDDVTCMLLKAESF |
Ga0209624_100282526 | 3300027895 | Forest Soil | ATPSEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE |
Ga0209415_103604872 | 3300027905 | Peatlands Soil | LAVLEGGKSGSPSDLLKLLMSDLDLFVGNTPQHDDVTCMLIKAEN |
Ga0209006_100762243 | 3300027908 | Forest Soil | PADMLKRLLAEVDFFVGSTPQHDDVTCLLLKSESF |
Ga0209006_107519032 | 3300027908 | Forest Soil | ADMLKRLMADLDLFVGSTPQHDDVTCLLLKAENFS |
Ga0209168_103430492 | 3300027986 | Surface Soil | GRSVEPHEMLKRLMAEVDLFVGNTPQHDDVTCMLLKSENF |
Ga0265356_10142141 | 3300028017 | Rhizosphere | GVASTPKELLARLMANLDLFVGATPQHDDVTCLLVKAE |
Ga0209526_101647062 | 3300028047 | Forest Soil | GMSESPSEMLKRLMTELDLFVGNTPQHDDVTCMLLKAETN |
Ga0137415_101115151 | 3300028536 | Vadose Zone Soil | AIEAGTSGRPSDMLKRLMAELDLFVGNTPQHDDVTCMLLKAET |
Ga0247819_107718382 | 3300028608 | Soil | TGLCVNAGADTSSANMLSRAMADLDLFVGNTPQHADITCLLIKYG |
Ga0302218_102037162 | 3300028863 | Palsa | SATPKGFLDQLMANLDLFVGATPQHDDVTCLLVKAE |
Ga0302229_104954391 | 3300028879 | Palsa | PQQLLDRLMADLDLFVGSTPQHDDVTCLLIKAENL |
Ga0302200_101898661 | 3300028909 | Bog | TPAEMLQRMLAGLDLFVGNTPQHDDVTCLLIKAENA |
Ga0311358_109952262 | 3300029915 | Bog | ASTPAEMLQRMLAGLDLFVGNTPQHDDVTCLLIKAENA |
Ga0302143_11024162 | 3300029918 | Bog | AASTPAEMLNRMMAAVDLFVGSTPQHDDVTCLLVKAE |
Ga0316363_100751843 | 3300030659 | Peatlands Soil | AATTPADMLKRFMAELDLFVGNTPQHDDVTCLLVKAENL |
Ga0302180_100519981 | 3300031028 | Palsa | TIAAGATLTPSEMLKRLMTELDLFVGQTPQHDDVTLMLLKAE |
Ga0307474_100960671 | 3300031718 | Hardwood Forest Soil | TAPSDMLKRLMAEVDLFVGSTPQHDDVTCLLVKAE |
Ga0307477_107835031 | 3300031753 | Hardwood Forest Soil | KTVEPGEMLKRLMAELDLFVGNTPQHDDVTCMLLKAEALHA |
Ga0307475_110716141 | 3300031754 | Hardwood Forest Soil | DGAATAPSDMLKRLMAEVDLFVGSTPQHDDVTCLLVKAENV |
Ga0307475_114842702 | 3300031754 | Hardwood Forest Soil | PGTLLKRLMSALDLFVGNTPQHDDVTCMLLKSQAP |
Ga0307478_111622123 | 3300031823 | Hardwood Forest Soil | AGAAATPSEMLNRLMAELDLFVGNTPQHDDVTCLLVKAE |
Ga0307478_118125431 | 3300031823 | Hardwood Forest Soil | GSASTPPEMLNRFMAELDLFVGLTPQHDDVTCLLIKATEKEI |
Ga0311301_105026231 | 3300032160 | Peatlands Soil | GSPSDLLKLLMSDLDLFVGNTPQHDDVTCMLIKAEN |
Ga0335079_104923622 | 3300032783 | Soil | AIETNRSVEPVEMLKRLMAELDLFVGNTPQHDDMTCLLLKSE |
Ga0335078_101740421 | 3300032805 | Soil | LLQAGSSSTPEELLRRLMSDLDFFVGTTPQHDDVTCMLVKTS |
Ga0335078_116636911 | 3300032805 | Soil | TATPDELLRRLMADLDAFVGVTPQHDDVTCMLVKVG |
Ga0335083_100759815 | 3300032954 | Soil | ESPSMLLQRIMNDVDNFVGTAPQHDDVTCMLLKSV |
⦗Top⦘ |