NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069122

Metagenome / Metatranscriptome Family F069122

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069122
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 40 residues
Representative Sequence MGNEDSYVALGLKVWKAQIDRADKLFGGLSSEEVLREIAPG
Number of Associated Samples 105
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.77 %
% of genes near scaffold ends (potentially truncated) 97.58 %
% of genes from short scaffolds (< 2000 bps) 93.55 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.129 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.806 % of family members)
Environment Ontology (ENVO) Unclassified
(32.258 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.548 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.83%    β-sheet: 0.00%    Coil/Unstructured: 52.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF028262-Hacid_dh_C 24.19
PF12680SnoaL_2 18.55
PF02321OEP 7.26
PF13561adh_short_C2 3.23
PF02082Rrf2 3.23
PF07883Cupin_2 2.42
PF12697Abhydrolase_6 2.42
PF00753Lactamase_B 2.42
PF00106adh_short 1.61
PF07366SnoaL 1.61
PF00313CSD 0.81
PF05368NmrA 0.81
PF02852Pyr_redox_dim 0.81
PF02954HTH_8 0.81
PF08447PAS_3 0.81
PF13602ADH_zinc_N_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 14.52
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 3.23
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 3.23
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 3.23
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 3.23
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 3.23
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 3.23
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 3.23
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 3.23

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.13 %
UnclassifiedrootN/A8.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02G9AK5All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300001545|JGI12630J15595_10059414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. 23TSA30-6758Open in IMG/M
3300001593|JGI12635J15846_10233034All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300002245|JGIcombinedJ26739_100008947All Organisms → cellular organisms → Bacteria8029Open in IMG/M
3300002245|JGIcombinedJ26739_100961870All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005333|Ga0070677_10418664All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005347|Ga0070668_102242081All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005440|Ga0070705_100716622All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005456|Ga0070678_101700339All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005467|Ga0070706_100587277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1035Open in IMG/M
3300005467|Ga0070706_101065434All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005468|Ga0070707_101932137All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005538|Ga0070731_10632923All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005541|Ga0070733_10278773All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300005552|Ga0066701_10357395All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae904Open in IMG/M
3300005575|Ga0066702_10784595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae567Open in IMG/M
3300005843|Ga0068860_100053232All Organisms → cellular organisms → Bacteria3849Open in IMG/M
3300006175|Ga0070712_101954428All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300006358|Ga0068871_101580307All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300006796|Ga0066665_10299892All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300006852|Ga0075433_11862208All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006854|Ga0075425_103037857All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006871|Ga0075434_100998228All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300007076|Ga0075435_101332265Not Available629Open in IMG/M
3300007076|Ga0075435_101352992All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300007076|Ga0075435_101427639All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300007265|Ga0099794_10557215All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium605Open in IMG/M
3300007788|Ga0099795_10096775All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300009088|Ga0099830_10987886All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7697Open in IMG/M
3300009089|Ga0099828_10486294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. OK2331113Open in IMG/M
3300009156|Ga0111538_12525509All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7644Open in IMG/M
3300009156|Ga0111538_12662465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7627Open in IMG/M
3300010304|Ga0134088_10139384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis1151Open in IMG/M
3300010343|Ga0074044_10162653All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300010400|Ga0134122_11613192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium673Open in IMG/M
3300010403|Ga0134123_10586471All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D71068Open in IMG/M
3300011269|Ga0137392_10801821Not Available778Open in IMG/M
3300011270|Ga0137391_10502372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis1026Open in IMG/M
3300011270|Ga0137391_10967585All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300012096|Ga0137389_10560928All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300012203|Ga0137399_10243473All Organisms → cellular organisms → Bacteria → Acidobacteria1473Open in IMG/M
3300012401|Ga0134055_1177639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7773Open in IMG/M
3300012582|Ga0137358_10129898All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300012683|Ga0137398_10030654All Organisms → cellular organisms → Bacteria3039Open in IMG/M
3300012683|Ga0137398_10469964All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7862Open in IMG/M
3300012685|Ga0137397_11184076All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012917|Ga0137395_10230943All Organisms → cellular organisms → Bacteria → Acidobacteria1295Open in IMG/M
3300012918|Ga0137396_10647416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. 23TSA30-6781Open in IMG/M
3300012922|Ga0137394_10122091All Organisms → cellular organisms → Bacteria → Proteobacteria2206Open in IMG/M
3300012923|Ga0137359_11121849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola672Open in IMG/M
3300012924|Ga0137413_10047044All Organisms → cellular organisms → Bacteria2478Open in IMG/M
3300012924|Ga0137413_10277502All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300012924|Ga0137413_11043992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. 23TSA30-6643Open in IMG/M
3300012929|Ga0137404_10772855Not Available872Open in IMG/M
3300012930|Ga0137407_10483149All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300013296|Ga0157374_11558463All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300015054|Ga0137420_1154558All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300018013|Ga0187873_1309347All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300019885|Ga0193747_1048073All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D71061Open in IMG/M
3300019887|Ga0193729_1204104All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7670Open in IMG/M
3300020199|Ga0179592_10085407All Organisms → cellular organisms → Bacteria → Acidobacteria1448Open in IMG/M
3300020580|Ga0210403_11500414Not Available507Open in IMG/M
3300020581|Ga0210399_11484833All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300020583|Ga0210401_11222933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis609Open in IMG/M
3300021088|Ga0210404_10517137All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300021168|Ga0210406_10857039Not Available687Open in IMG/M
3300021171|Ga0210405_10583401Not Available871Open in IMG/M
3300021178|Ga0210408_10501715Not Available964Open in IMG/M
3300021178|Ga0210408_10677229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis813Open in IMG/M
3300021363|Ga0193699_10470241Not Available516Open in IMG/M
3300021405|Ga0210387_10607763All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300021406|Ga0210386_10969432All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300021420|Ga0210394_11302328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis621Open in IMG/M
3300021420|Ga0210394_11713715All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021474|Ga0210390_11304745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis582Open in IMG/M
3300021479|Ga0210410_10442742All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300021479|Ga0210410_10820694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis815Open in IMG/M
3300021479|Ga0210410_10934020All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300022533|Ga0242662_10323183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans520Open in IMG/M
3300024288|Ga0179589_10343320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7677Open in IMG/M
3300024330|Ga0137417_1492408Not Available1276Open in IMG/M
3300025477|Ga0208192_1071800All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300025926|Ga0207659_10356242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D71215Open in IMG/M
3300026035|Ga0207703_10333025All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300026118|Ga0207675_101765167All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7638Open in IMG/M
3300026285|Ga0209438_1098087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7894Open in IMG/M
3300026304|Ga0209240_1130556All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300026319|Ga0209647_1098698All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300026319|Ga0209647_1157747All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7938Open in IMG/M
3300026469|Ga0257169_1046743All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300026508|Ga0257161_1131407All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300026515|Ga0257158_1124407All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300026532|Ga0209160_1277009All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300026557|Ga0179587_10027521All Organisms → cellular organisms → Bacteria → Acidobacteria3126Open in IMG/M
3300026557|Ga0179587_10483597All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300027537|Ga0209419_1063962All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300027587|Ga0209220_1154145All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300027610|Ga0209528_1150050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis509Open in IMG/M
3300027643|Ga0209076_1032331All Organisms → cellular organisms → Bacteria → Acidobacteria1460Open in IMG/M
3300027671|Ga0209588_1091489All Organisms → cellular organisms → Bacteria → Acidobacteria980Open in IMG/M
3300027729|Ga0209248_10050177All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300027862|Ga0209701_10721427All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027875|Ga0209283_10562679Not Available727Open in IMG/M
3300027889|Ga0209380_10061400All Organisms → cellular organisms → Bacteria → Proteobacteria2138Open in IMG/M
3300028587|Ga0247828_10548891All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7696Open in IMG/M
3300028784|Ga0307282_10135672All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D71160Open in IMG/M
3300028906|Ga0308309_10475930All Organisms → cellular organisms → Bacteria → Acidobacteria1078Open in IMG/M
3300028906|Ga0308309_11044441All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300029636|Ga0222749_10411485Not Available718Open in IMG/M
3300029636|Ga0222749_10594544All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300031057|Ga0170834_111702647All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300031057|Ga0170834_111847351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis1156Open in IMG/M
3300031446|Ga0170820_14550939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis552Open in IMG/M
3300031718|Ga0307474_10954164All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300031820|Ga0307473_10225472All Organisms → cellular organisms → Bacteria → Acidobacteria1131Open in IMG/M
3300031823|Ga0307478_11012631All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300031892|Ga0310893_10564361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7517Open in IMG/M
3300031940|Ga0310901_10218571All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7768Open in IMG/M
3300031954|Ga0306926_12264460All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300031962|Ga0307479_10111293All Organisms → cellular organisms → Bacteria2664Open in IMG/M
3300032174|Ga0307470_10209907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis1252Open in IMG/M
3300032174|Ga0307470_10779038All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300032180|Ga0307471_101995735All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300032205|Ga0307472_101693349All Organisms → cellular organisms → Bacteria624Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.23%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.81%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_119282402170459005Grass SoilMENEGSYVALGLKVWKTQIERADKLFGSLLSEDVLREIAP
JGI12630J15595_1005941413300001545Forest SoilMGNEGSYVALGLKVWKAQIERADKLFRSLSSDDVLREIAPG
JGI12635J15846_1023303413300001593Forest SoilMGNEDSCVAVGLKVRKSQIDRVDKLFGTLSSDEVLREIAPGRNRL
JGIcombinedJ26739_100008947103300002245Forest SoilMKMEMGNEGSCIALTLKVWKAQIERADKLSGSLSSEEVLREIK*
JGIcombinedJ26739_10096187033300002245Forest SoilMENQGSYVALGLKVWKAQIERADKLFEGLSSEDLLREIAPGR
Ga0070677_1041866413300005333Miscanthus RhizosphereMANDLPCVALALKAWKTQIDRADKLFGALSSEEVLREIAPGR
Ga0070668_10224208113300005347Switchgrass RhizosphereMGNDPSCVALGLKGWKTQIDRADKLFGSLSSEEVLREIAPGR
Ga0070705_10071662213300005440Corn, Switchgrass And Miscanthus RhizosphereMANEGTYVALGLKVWKAQIERADKLFGSLSSEEVLREIAP
Ga0070678_10170033913300005456Miscanthus RhizosphereMADDLPFVALALKSWKTQVDRAEKLFGALSSDELLREIAPGRN
Ga0070706_10058727713300005467Corn, Switchgrass And Miscanthus RhizosphereMENEGSYVALGLKVWKTQIGRADKLFGSLSSENVLGEIAPG
Ga0070706_10106543423300005467Corn, Switchgrass And Miscanthus RhizosphereMGNDLSCAALALKVWKTQIDRADKLFGALSSEEVLREIAPGRN
Ga0070707_10193213713300005468Corn, Switchgrass And Miscanthus RhizosphereMVVEGDGDMGNDLSCAALALKVWKTQIDRADKLFGALSSEEVLREI
Ga0070731_1063292313300005538Surface SoilMGNDDAYVSLGLKVWKAQIERADKLFGGLSPEEVLREIAPGRN
Ga0070733_1027877323300005541Surface SoilMGNEGSYVALGLKAWKAQIGRADTLFGALSSEQVLREIAPDRNR
Ga0066701_1035739513300005552SoilMTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLREIA
Ga0066702_1078459523300005575SoilMGNEGSYVALGLKVWKAQIDRADKLFGSPSSEEVLREIAPGRN
Ga0068860_10005323213300005843Switchgrass RhizosphereMGNEGSYVALALKTWTAQIDRADKLFGRLSSEEVLREIAPGRN
Ga0070712_10195442813300006175Corn, Switchgrass And Miscanthus RhizosphereMGNEGSYVALGLKTWNTQIDRADKLFGGLSSEEILREIAPG
Ga0068871_10158030713300006358Miscanthus RhizosphereMGNEGTHVALGLKAWKAQIERADKLFGTLSSEEVLGEIAPGRNR
Ga0066665_1029989233300006796SoilMANEGSYVALALRVWKAQIERADKLFGGLSSEEVLREI
Ga0075433_1186220823300006852Populus RhizosphereMENEGSCVALGLKAWKTQIDRADKLFGALSSEDVLREIA
Ga0075425_10303785723300006854Populus RhizosphereMGNEGTYVALGLKVWKAQIERADKLFGSLSSEEVLRE
Ga0075434_10099822813300006871Populus RhizosphereMGNEFSYVALGLKTWNAQIDRADKLFGDLSSEEVLR
Ga0075435_10133226513300007076Populus RhizosphereMGNDLSCEALGLKVWKNQIDRADKLFGSLSSEEVLREI
Ga0075435_10135299213300007076Populus RhizosphereMANEGSYVALALKVWKAQIERADKLFGGLSSEEVLRE
Ga0075435_10142763923300007076Populus RhizosphereMENEGSCVALGLRAWKTQIDRADKLFGALSSEEVLREIAPGRN
Ga0099794_1055721513300007265Vadose Zone SoilMGNDSSFAALGLKAWKTQIDRADKLFGALSSEQVLREIAP
Ga0099795_1009677533300007788Vadose Zone SoilMGNEGSYVALGLKTWNAQIDRADKLFAGLSSEEIL
Ga0099830_1098788613300009088Vadose Zone SoilMGTDDAYIALGLKVWKAQIERADKLFGSLSSEEVQREIAPG
Ga0099828_1048629433300009089Vadose Zone SoilMGNDGACVALGLKVWKTQIDRADKLFGTLSSEEVLREIAPG
Ga0111538_1252550923300009156Populus RhizosphereMADDLPFVALALKSWKTQVDRAEKLFGALSSEEVLREIAPGR
Ga0111538_1266246513300009156Populus RhizosphereMADDLPFVALALKSWKTQVDRAEKLFGALSSDELLREIAP
Ga0134088_1013938413300010304Grasslands SoilMGNEDSCVALGLKVWKAQLERADKLFGSLSSDDVLREIAP
Ga0074044_1016265343300010343Bog Forest SoilMGNEGSYVALGLKTWNTQIDRADKLFGGLSSEEILREI
Ga0134122_1161319223300010400Terrestrial SoilMGNEGSCVAIGLKAWKTQIDQADKLFGTLSSEEVLGEIA
Ga0134123_1058647113300010403Terrestrial SoilMADDLPFVALALKSWKTQVDRAEKLFGALSSDELLRE
Ga0137392_1080182133300011269Vadose Zone SoilMGNDGWVALGLKAWKTQIDRADRLFGTLSSEDVLREIAPGR
Ga0137391_1050237233300011270Vadose Zone SoilMRGDGAMTNEGSYVALGLKVWKAQLDRADKLFGGLSSEE
Ga0137391_1096758523300011270Vadose Zone SoilMTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLREI
Ga0137389_1056092833300012096Vadose Zone SoilMRGDGTMANEGSYVALGLKVWKAQLERADKLFGGLSSEEVL
Ga0137399_1024347313300012203Vadose Zone SoilMRNEGSCVALGLKAWKTQIDRADKFFGTLSSEEVM
Ga0134055_117763913300012401Grasslands SoilVVDRSWFMGNEGSYVALGLKAWKAQIERADKLFGSLSSEEVLREIAP
Ga0137358_1012989823300012582Vadose Zone SoilMANDPSLAALGLNPWTTQIDRAATLSGSLSSEEVLREIAPG
Ga0137398_1003065413300012683Vadose Zone SoilMGNEGSYVALGLKTWNAQIDLADKLFGGLSSDEILREI
Ga0137398_1046996413300012683Vadose Zone SoilMTNDPSFAALGLKAWKTQIDRADKLFGSLSSEEVLREIAPGRN
Ga0137397_1118407623300012685Vadose Zone SoilMGNEGTYVALGLKVWKAQIERADKLFGSLSSGEVLREIAPG
Ga0137395_1023094333300012917Vadose Zone SoilMENEGSYVALGLKVWKTQIGRADKLFGSLSSEDVLREI
Ga0137396_1064741613300012918Vadose Zone SoilMGNEGSYVALGLKVWKAQIERADKLFGSLSSEEVL
Ga0137394_1012209143300012922Vadose Zone SoilVVDRRWSMGNDPSCVALGLKAWKTQIDRADKLFGSLSSEEVL
Ga0137359_1112184923300012923Vadose Zone SoilVGNEGSYVALGLKAWKTQIERADKLFGNLSPEGALREIAPGRNR
Ga0137413_1004704453300012924Vadose Zone SoilMGNEGSYVTLGLKTWNAQIDRADKLFGGLSSEEILREIAPG
Ga0137413_1027750223300012924Vadose Zone SoilMGTDGASLGLKVWKAQIERAEKLFGSLSSEEVQREIAPGRNRLLY
Ga0137413_1104399213300012924Vadose Zone SoilMGNEGSYVALGLKIWKAQIDRADKLFGSLSSEEVQHEI
Ga0137404_1077285513300012929Vadose Zone SoilVANEDSYVALGLKAWRAQIERADKLFGSLSSEEVLREIAPGR
Ga0137407_1048314933300012930Vadose Zone SoilMGNEVSYVALGLKTWNAQIDRADKLFGGLSSEEILREIA
Ga0157374_1155846313300013296Miscanthus RhizosphereMGNEGSYVALGLKAWKAQIDRVDTLFGALSSEQVLREIAPDRNRLLYLW
Ga0137420_115455813300015054Vadose Zone SoilMGNEVTYVALGLKTWNAQIDRADKLFGGLSSEEILR
Ga0187873_130934713300018013PeatlandMGNEASYTTLGLKAWKAQVDRADKLFGTLSSEQVLQQIAPGRN
Ga0193747_104807313300019885SoilMGNEGSYAALGLKAWKTQIDRADKLFENLSSEEVLREI
Ga0193729_120410413300019887SoilMANDPSFVALGLKSWKTQIDRADKLLGGFSSEEILREI
Ga0179592_1008540733300020199Vadose Zone SoilMTNEGSYVAVGLKMWKTQIGRADKLFGSLSFEDVLREIAPGRN
Ga0210403_1150041423300020580SoilMGNEDSYVALGLKVWKAQIDRADKLFGSLSSEDLLREIAPGR
Ga0210399_1148483313300020581SoilMGNEGSYVALGLKVWKAQIERADKLFGSLSSEEVLREI
Ga0210401_1122293323300020583SoilMGNEGSYVALGLKTWNAQIDRADKLFGGLSSEEILREI
Ga0210404_1051713713300021088SoilMGNEFSYVALGLKTWNAQINRADKLFGGLSSEEILREI
Ga0210406_1085703913300021168SoilMKMEMGNEGSCIALTLKVWKAQIERADKLSGSLSSEEVLREIK
Ga0210405_1058340133300021171SoilMGNEGSYVALGLKTWNAQIDRADKLFGGFSPEELLREIAPG
Ga0210408_1050171533300021178SoilSTNIALTLKVWKAQIERADKLFGSLSSEEVLREIK
Ga0210408_1067722933300021178SoilMGNEGSYVALGLKTWNAQIDRADKLFGGLSSEEILREIAP
Ga0193699_1047024113300021363SoilMGNDPSCVALGLRGWKTQVDRADKLFGSLSSEDVLREIAL
Ga0210387_1060776333300021405SoilMGNEGSYTALGLKVWKAQVDRADKLFGTLSSEQILQEIAPGR
Ga0210386_1096943213300021406SoilMGNDDAYVSLGLKVWKAQIERADKLFGGLTSEEVLREIAPARNR
Ga0210394_1130232813300021420SoilMGNDDAYVSLGLKVWKAQIERADKLFGGLSSEEVLREIA
Ga0210394_1171371513300021420SoilMGNEGSYIALGLKVWKTQIDRADKVFGGLSSEEVLREIAPGR
Ga0210390_1130474513300021474SoilMGNDDAYVSLGLKVWKAQIERADKLFGGLTSEEVLREIA
Ga0210410_1044274233300021479SoilMANEGSYVALALKVWKTQVDRADKLFGGLSSEEVLREIA
Ga0210410_1082069433300021479SoilMGNEGSYVALGLKTWNAQIDRADKLFGGLSSEEILREIAPGR
Ga0210410_1093402013300021479SoilMGNDDAYVSLGLKVWKAQIERADKLFGGLSSEEVLREIAPGRN
Ga0242662_1032318313300022533SoilMANEGSYVALGLKVWKAQIERADKLFGSLSSEEIL
Ga0179589_1034332023300024288Vadose Zone SoilMGTDGAYVALGLEVWKAQIERAEKLFGSLSSEEVQR
Ga0137417_149240813300024330Vadose Zone SoilMANDPSCVALALKVWKTQIDRADKLFGSLSSEEVLRK
Ga0208192_107180023300025477PeatlandMGNEGSYTALGLKVWKAQVDRADKLFGTLSSEQILQEIAPGRN
Ga0207659_1035624213300025926Miscanthus RhizosphereMGTDPSCVALALKAWKTQIDRAGKLFGALSSEEVLREIAPGRNLSLMS
Ga0207703_1033302513300026035Switchgrass RhizosphereMGNEGSYVALGLKTWNTQIDRADKLFGGLSSEEILREIAPGR
Ga0207675_10176516713300026118Switchgrass RhizosphereMGTDPSCVALALKAWKTQIDLTDTLFGALSSEEVLREIAPERR
Ga0209438_109808723300026285Grasslands SoilMGNDPSCVALALKAWKTQIDRADKLFGSLSSEEVLRE
Ga0209240_113055633300026304Grasslands SoilMENEGSYVALGLKMWKTQIGRADKLFGSLSFEDVLREIA
Ga0209647_109869833300026319Grasslands SoilMANEGSYVALGLKVWKAQIERADKLFGGFSSEEVVREIAP
Ga0209647_115774713300026319Grasslands SoilMGNDGSCVALGLKAWKTQIDRADKLFGSLSSEEVLREIAP
Ga0257169_104674313300026469SoilMANEGSYVALALKVWKAQIERADKLFGGLSSEEVLREIAP
Ga0257161_113140723300026508SoilMENQGSYVALGLNVWKTQIGRADKLFGSLSLKDVLRE
Ga0257158_112440723300026515SoilMENESPYVAVGLKVWKAQIERADKVFGSLSPEDVQREIGP
Ga0209160_127700913300026532SoilMANEGSYVALALKVWKAQIERADKLFGGLSSDEALREIAPGRN
Ga0179587_1002752133300026557Vadose Zone SoilMENEGSYVALGLKMWKTQIGRADKLFGSLSFEDVLREIAPGR
Ga0179587_1048359713300026557Vadose Zone SoilMGNEGSYVALGLKTWNAQIDRADKLFAGLSSEEILREIAPG
Ga0209419_106396213300027537Forest SoilMGNEGSYAALGLKVWKAQVDRADKLFGTLSSEQVLQEIAPGRN
Ga0209220_115414513300027587Forest SoilMGNEGSYVALGLKVWRAQIERAGKLFGGLSSEEVLREIAPG
Ga0209528_115005013300027610Forest SoilVENQGSYVALGLKVWKAQIERADKLFGGLLSEDLLREIAPG
Ga0209076_103233133300027643Vadose Zone SoilMTNEGSYVAVGLKMWKTQIGRADKLFGSLSFEDVLREIAP
Ga0209588_109148933300027671Vadose Zone SoilMTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLQEIAPG
Ga0209248_1005017743300027729Bog Forest SoilMENEGSYVALGLKTWNTQIDRADKLFGGFSSEEILREI
Ga0209701_1072142723300027862Vadose Zone SoilMGNESSCVALALKVWKIQIDRADKLFGALSSEEVLR
Ga0209283_1056267923300027875Vadose Zone SoilMGNDGACVALGLKAWKNQIDRADKLFGTLSSEEVL
Ga0209380_1006140013300027889SoilMEHDGACVALGLKAWKTQIDRADKLFGTLSSEEVLREIA
Ga0247828_1054889123300028587SoilMVDDLPCVALALKAWKTQIDRADKLFGALSSEEVLREI
Ga0307282_1013567213300028784SoilMGNDPSCVALGLKAWKTQIDRADKLFGSLSSEEVLREIAPG
Ga0308309_1047593013300028906SoilMEIEGSYIALGLKVWKTQIERADKLFGRLSSEEVLREIAPG
Ga0308309_1104444113300028906SoilMENEASYVALGLKVWKAQIERADKLFGSLSSEHVLREIA
Ga0222749_1041148513300029636SoilMGNEGSYVALGLKVWKAQIERADKLFGSLSSEEVLREIK
Ga0222749_1059454413300029636SoilMTNEGSYVALGLKAWKGQLDRADKLFGGLSSEEVL
Ga0170834_11170264723300031057Forest SoilMANEGSYVALALKVWKTQIERADKLFAGLSSQEVLREIAPSR
Ga0170834_11184735133300031057Forest SoilMRDKTMGNEGSYAALGLKVWKAQIERADKLFGGLS
Ga0170820_1455093923300031446Forest SoilMGNEGTYVALGLKTWNAQIDRADKLFGGFSSEEILREIAPGRN
Ga0307474_1095416413300031718Hardwood Forest SoilMANEGSYVALGLKVWKAQIDRADKLFATLSSEEVLREIAPD
Ga0307473_1022547233300031820Hardwood Forest SoilMTNEGSYVALGLKVWKAQLDRADKLFGGLSAEEVLRE
Ga0307478_1101263133300031823Hardwood Forest SoilMGNEGSYVALGLKAWNAQIDRADKLFGGLSSEEILREIAPGRN
Ga0310893_1056436113300031892SoilMADDLPFVALALKSWKTQVDRAEKLFAALSSEDVLREIAPG
Ga0310901_1021857123300031940SoilMGTDPSCVALALKAWKTQIDRADKLFGALSSEEVLREIA
Ga0306926_1226446023300031954SoilMTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLREIAP
Ga0307479_1011129363300031962Hardwood Forest SoilMGNEGSFVALGLKTWNAQIDRADKLFGGLSSEEILLEI
Ga0307470_1020990743300032174Hardwood Forest SoilMGNEGSYVALGLKTWNAQIDRADKLFGGLSSDEILREIAPGRNR
Ga0307470_1077903823300032174Hardwood Forest SoilMGNEDSYVALGLKVWKAQIDRADKLFGGLSSEEVLREIAPG
Ga0307471_10199573513300032180Hardwood Forest SoilMGNEGSYVALGLKVWNAQIDRADKLFGSLSSEEILREIAPG
Ga0307472_10169334923300032205Hardwood Forest SoilMGNDLSCAALALKVWKTQIDRADKLFGALSSEEVLREIAPG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.