Basic Information | |
---|---|
Family ID | F069255 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 41 residues |
Representative Sequence | RGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.23 % |
% of genes near scaffold ends (potentially truncated) | 95.97 % |
% of genes from short scaffolds (< 2000 bps) | 89.52 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.065 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (20.161 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.419 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.742 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 24.64% Coil/Unstructured: 75.36% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF00732 | GMC_oxred_N | 6.45 |
PF07366 | SnoaL | 6.45 |
PF01035 | DNA_binding_1 | 3.23 |
PF13808 | DDE_Tnp_1_assoc | 2.42 |
PF03636 | Glyco_hydro_65N | 2.42 |
PF00583 | Acetyltransf_1 | 1.61 |
PF12680 | SnoaL_2 | 1.61 |
PF00440 | TetR_N | 1.61 |
PF13683 | rve_3 | 1.61 |
PF00072 | Response_reg | 0.81 |
PF07729 | FCD | 0.81 |
PF08843 | AbiEii | 0.81 |
PF13561 | adh_short_C2 | 0.81 |
PF00196 | GerE | 0.81 |
PF03284 | PHZA_PHZB | 0.81 |
PF03279 | Lip_A_acyltrans | 0.81 |
PF07045 | DUF1330 | 0.81 |
PF05199 | GMC_oxred_C | 0.81 |
PF00872 | Transposase_mut | 0.81 |
PF03136 | Pup_ligase | 0.81 |
PF01638 | HxlR | 0.81 |
PF13546 | DDE_5 | 0.81 |
PF13673 | Acetyltransf_10 | 0.81 |
PF00296 | Bac_luciferase | 0.81 |
PF00158 | Sigma54_activat | 0.81 |
PF13560 | HTH_31 | 0.81 |
PF13751 | DDE_Tnp_1_6 | 0.81 |
PF01799 | Fer2_2 | 0.81 |
PF01610 | DDE_Tnp_ISL3 | 0.81 |
PF13649 | Methyltransf_25 | 0.81 |
PF01872 | RibD_C | 0.81 |
PF00753 | Lactamase_B | 0.81 |
PF08241 | Methyltransf_11 | 0.81 |
PF01548 | DEDD_Tnp_IS110 | 0.81 |
PF12697 | Abhydrolase_6 | 0.81 |
PF00561 | Abhydrolase_1 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 7.26 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 3.23 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 3.23 |
COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 2.42 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.81 |
COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.81 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.81 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.81 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.81 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.81 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.81 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.81 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.87 % |
Unclassified | root | N/A | 41.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005093|Ga0062594_101527290 | Not Available | 687 | Open in IMG/M |
3300005434|Ga0070709_10001866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11429 | Open in IMG/M |
3300005434|Ga0070709_11137419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
3300005445|Ga0070708_101030154 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005445|Ga0070708_101306860 | Not Available | 677 | Open in IMG/M |
3300005467|Ga0070706_100075645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 3116 | Open in IMG/M |
3300005467|Ga0070706_100817352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
3300005468|Ga0070707_100058361 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 3701 | Open in IMG/M |
3300005468|Ga0070707_100131638 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
3300005468|Ga0070707_100259559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1690 | Open in IMG/M |
3300005518|Ga0070699_100962088 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300005518|Ga0070699_101539538 | Not Available | 609 | Open in IMG/M |
3300005518|Ga0070699_101592395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
3300005536|Ga0070697_100280918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1428 | Open in IMG/M |
3300005536|Ga0070697_101600240 | Not Available | 583 | Open in IMG/M |
3300005538|Ga0070731_10140263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1602 | Open in IMG/M |
3300005542|Ga0070732_10074333 | Not Available | 1983 | Open in IMG/M |
3300005610|Ga0070763_10675287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
3300005841|Ga0068863_101980302 | Not Available | 593 | Open in IMG/M |
3300005921|Ga0070766_10050891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2327 | Open in IMG/M |
3300005921|Ga0070766_10604786 | Not Available | 736 | Open in IMG/M |
3300006173|Ga0070716_100508044 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300006173|Ga0070716_101836168 | Not Available | 502 | Open in IMG/M |
3300006175|Ga0070712_100217542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1510 | Open in IMG/M |
3300006175|Ga0070712_100608283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 926 | Open in IMG/M |
3300006903|Ga0075426_11456349 | Not Available | 520 | Open in IMG/M |
3300006904|Ga0075424_102263304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
3300006904|Ga0075424_102689314 | Not Available | 519 | Open in IMG/M |
3300007255|Ga0099791_10130647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 1167 | Open in IMG/M |
3300007265|Ga0099794_10051131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1989 | Open in IMG/M |
3300009038|Ga0099829_11169560 | Not Available | 637 | Open in IMG/M |
3300009088|Ga0099830_10556278 | Not Available | 939 | Open in IMG/M |
3300009089|Ga0099828_10012395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6407 | Open in IMG/M |
3300009162|Ga0075423_10834865 | Not Available | 975 | Open in IMG/M |
3300010371|Ga0134125_10652250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1162 | Open in IMG/M |
3300010371|Ga0134125_11820929 | Not Available | 662 | Open in IMG/M |
3300010375|Ga0105239_11935714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
3300010396|Ga0134126_10173505 | Not Available | 2597 | Open in IMG/M |
3300010396|Ga0134126_10264780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2029 | Open in IMG/M |
3300010396|Ga0134126_10748219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1108 | Open in IMG/M |
3300010401|Ga0134121_10049054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3459 | Open in IMG/M |
3300010401|Ga0134121_10339749 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300011270|Ga0137391_11083000 | Not Available | 649 | Open in IMG/M |
3300011271|Ga0137393_10601648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300012096|Ga0137389_10748488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 839 | Open in IMG/M |
3300012096|Ga0137389_11213708 | Not Available | 646 | Open in IMG/M |
3300012198|Ga0137364_10865975 | Not Available | 683 | Open in IMG/M |
3300012198|Ga0137364_11173486 | Not Available | 576 | Open in IMG/M |
3300012205|Ga0137362_11370160 | Not Available | 593 | Open in IMG/M |
3300012363|Ga0137390_11818474 | Not Available | 540 | Open in IMG/M |
3300012960|Ga0164301_10170799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1354 | Open in IMG/M |
3300012985|Ga0164308_11488826 | Not Available | 621 | Open in IMG/M |
3300012987|Ga0164307_11836460 | Not Available | 514 | Open in IMG/M |
3300012988|Ga0164306_10916871 | Not Available | 715 | Open in IMG/M |
3300012989|Ga0164305_10216438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1359 | Open in IMG/M |
3300012989|Ga0164305_10435816 | Not Available | 1014 | Open in IMG/M |
3300012989|Ga0164305_12082501 | Not Available | 520 | Open in IMG/M |
3300013105|Ga0157369_11569238 | Not Available | 669 | Open in IMG/M |
3300013296|Ga0157374_11392806 | Not Available | 724 | Open in IMG/M |
3300014501|Ga0182024_11776510 | Not Available | 691 | Open in IMG/M |
3300015371|Ga0132258_13864729 | Not Available | 1019 | Open in IMG/M |
3300015372|Ga0132256_102584610 | Not Available | 608 | Open in IMG/M |
3300020580|Ga0210403_11285647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
3300020582|Ga0210395_11320485 | Not Available | 528 | Open in IMG/M |
3300020583|Ga0210401_10478870 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300020583|Ga0210401_10646951 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300021086|Ga0179596_10129842 | Not Available | 1180 | Open in IMG/M |
3300021088|Ga0210404_10048779 | Not Available | 1982 | Open in IMG/M |
3300021171|Ga0210405_10638015 | Not Available | 827 | Open in IMG/M |
3300021171|Ga0210405_10999121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
3300021403|Ga0210397_10477636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 941 | Open in IMG/M |
3300021404|Ga0210389_10593474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 870 | Open in IMG/M |
3300021406|Ga0210386_10162763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1872 | Open in IMG/M |
3300021432|Ga0210384_10901041 | Not Available | 785 | Open in IMG/M |
3300021474|Ga0210390_10144676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2001 | Open in IMG/M |
3300021474|Ga0210390_11038148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300021478|Ga0210402_10970826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
3300021478|Ga0210402_11839940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300021559|Ga0210409_11210629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
3300022724|Ga0242665_10207429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300024181|Ga0247693_1064361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300025900|Ga0207710_10484733 | Not Available | 641 | Open in IMG/M |
3300025906|Ga0207699_10210367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1322 | Open in IMG/M |
3300025906|Ga0207699_10615707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
3300025915|Ga0207693_10002834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15019 | Open in IMG/M |
3300025915|Ga0207693_10353126 | Not Available | 1150 | Open in IMG/M |
3300025915|Ga0207693_11264158 | Not Available | 554 | Open in IMG/M |
3300025916|Ga0207663_11143316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300025927|Ga0207687_10938433 | Not Available | 741 | Open in IMG/M |
3300025928|Ga0207700_10077781 | Not Available | 2578 | Open in IMG/M |
3300025929|Ga0207664_10082094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2624 | Open in IMG/M |
3300025929|Ga0207664_10796191 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300027842|Ga0209580_10179642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1047 | Open in IMG/M |
3300027855|Ga0209693_10458095 | Not Available | 613 | Open in IMG/M |
3300028072|Ga0247675_1035278 | Not Available | 733 | Open in IMG/M |
3300028792|Ga0307504_10412587 | Not Available | 534 | Open in IMG/M |
3300028906|Ga0308309_10688516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter liuii | 888 | Open in IMG/M |
3300029636|Ga0222749_10157751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1110 | Open in IMG/M |
3300031128|Ga0170823_10578762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1215 | Open in IMG/M |
3300031715|Ga0307476_10834557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 681 | Open in IMG/M |
3300031715|Ga0307476_11443097 | Not Available | 500 | Open in IMG/M |
3300031718|Ga0307474_10197688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 1529 | Open in IMG/M |
3300031718|Ga0307474_10702788 | Not Available | 799 | Open in IMG/M |
3300031718|Ga0307474_10827232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300031720|Ga0307469_10666187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 939 | Open in IMG/M |
3300031720|Ga0307469_11085022 | Not Available | 751 | Open in IMG/M |
3300031753|Ga0307477_10427834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
3300031753|Ga0307477_10701745 | Not Available | 677 | Open in IMG/M |
3300031754|Ga0307475_11050736 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031820|Ga0307473_10077422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1692 | Open in IMG/M |
3300031820|Ga0307473_10474270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 839 | Open in IMG/M |
3300031820|Ga0307473_11441960 | Not Available | 520 | Open in IMG/M |
3300031823|Ga0307478_11080993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
3300031962|Ga0307479_10436427 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300031962|Ga0307479_10634737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
3300031962|Ga0307479_11052274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
3300031962|Ga0307479_11506744 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300031962|Ga0307479_12071259 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300032174|Ga0307470_10263653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1146 | Open in IMG/M |
3300032174|Ga0307470_10411047 | Not Available | 960 | Open in IMG/M |
3300032174|Ga0307470_10509241 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300032180|Ga0307471_100797796 | Not Available | 1111 | Open in IMG/M |
3300032205|Ga0307472_100123487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1836 | Open in IMG/M |
3300034818|Ga0373950_0136804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 20.16% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 19.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.13% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.23% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062594_1015272901 | 3300005093 | Soil | ELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0070709_100018661 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KAELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA* |
Ga0070709_111374191 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTRRGVVLQGEFETDEVRSIFTAPQTTFGVTLHLMEYKGRGKGA* |
Ga0070708_1010301541 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA* |
Ga0070708_1013068601 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTRRGVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTGA* |
Ga0070706_1000756453 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVVLQGEFKTDEVHSIFTAPQTTFGLTLQFTEYKGRGKGA* |
Ga0070706_1008173521 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA* |
Ga0070707_1000583611 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA* |
Ga0070707_1001316381 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGMGA* |
Ga0070707_1002595591 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTGA* |
Ga0070699_1009620881 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA* |
Ga0070699_1015395382 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRRGVLLEGEFETDEVHFIFTVPQTTFGVTLQLMEHKSRGTGA* |
Ga0070699_1015923951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRGVVLEGEGETDEVHWIFTAPQSTFGVTLHLMEHKGRGTGA* |
Ga0070697_1002809183 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVLQGEFKTDEVHMIFTAPQTTFGVTLQLMEYKGRGKGA* |
Ga0070697_1016002401 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RRGVVLQGEVETDEVHFIFTAPQTTFGVTLQLMQHKARGTGA* |
Ga0070731_101402631 | 3300005538 | Surface Soil | RRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGHGTGA* |
Ga0070732_100743332 | 3300005542 | Surface Soil | GVVLQGEVETDDVHFIFTAPQTTFGVTLQLMEHKARATGA* |
Ga0070763_106752871 | 3300005610 | Soil | ELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKDRRTGA* |
Ga0068863_1019803023 | 3300005841 | Switchgrass Rhizosphere | RRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0070766_100508913 | 3300005921 | Soil | QGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0070766_106047863 | 3300005921 | Soil | TRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLLEHKGRRTGA* |
Ga0070716_1005080441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRGVALEGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTGA* |
Ga0070716_1018361682 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA* |
Ga0070712_1002175422 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGEVKTDEVHFIFTAPQTTFGVTLQLMEHKGRRTGA* |
Ga0070712_1006082831 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTGAAG* |
Ga0075426_114563491 | 3300006903 | Populus Rhizosphere | LQGEVNTDEVHFIFTAPQTTFGVKLQLMQDKARGTGA* |
Ga0075424_1022633042 | 3300006904 | Populus Rhizosphere | RGVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKNRGTGA* |
Ga0075424_1026893141 | 3300006904 | Populus Rhizosphere | GVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0099791_101306472 | 3300007255 | Vadose Zone Soil | LLETDEVRSIFTAPETTFGVALHLMEHTNRGTGK* |
Ga0099794_100511311 | 3300007265 | Vadose Zone Soil | LQGEFKTDEVHMIFTAPQTTFGVTLQLMEHKGRGKGA* |
Ga0099829_111695602 | 3300009038 | Vadose Zone Soil | AELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKSRGTGA* |
Ga0099830_105562782 | 3300009088 | Vadose Zone Soil | VVLQGEYETDDVHYVFTAPETTFGVTLHLMEHKNRGTSE* |
Ga0099828_100123951 | 3300009089 | Vadose Zone Soil | VVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTRA* |
Ga0075423_108348651 | 3300009162 | Populus Rhizosphere | LQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0134125_106522502 | 3300010371 | Terrestrial Soil | LQGEFETDEVRSIFTAPQTTFGVTLHLMEHKGRATGE* |
Ga0134125_118209291 | 3300010371 | Terrestrial Soil | RRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGP* |
Ga0105239_119357141 | 3300010375 | Corn Rhizosphere | ELTRRGVVLQGEFETDEVRSIFTAPQTTFGVTLHLMEHKGRATGE* |
Ga0134126_101735053 | 3300010396 | Terrestrial Soil | TRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0134126_102647801 | 3300010396 | Terrestrial Soil | TRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTA* |
Ga0134126_107482191 | 3300010396 | Terrestrial Soil | GVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKNRGTGA* |
Ga0134121_100490541 | 3300010401 | Terrestrial Soil | AELTRRGVILQGEFKTDEVHMIFTAPETTFGVTLHLMEHKGRRTGE* |
Ga0134121_103397492 | 3300010401 | Terrestrial Soil | QGEFETDEVRSIFTAPQTTFGVTLHLMEYKGRGTGA* |
Ga0137391_110830001 | 3300011270 | Vadose Zone Soil | GVVLQGEFETDEVRSIFTAPQTTFGVTLHLMEHKGRRTGA* |
Ga0137393_106016483 | 3300011271 | Vadose Zone Soil | QGEYETDDVHYVFTAPETTFGVTLHLMEHKYRGTSE* |
Ga0137389_107484882 | 3300012096 | Vadose Zone Soil | EFKTDEVHMIFTAPQTTFGVTLQLMEHKGRGKGA* |
Ga0137389_112137081 | 3300012096 | Vadose Zone Soil | ELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKSRGTGA* |
Ga0137364_108659751 | 3300012198 | Vadose Zone Soil | VVLQGEFETDEVRSIFTAPETTFGVTLQLMEYKGRGKGA* |
Ga0137364_111734861 | 3300012198 | Vadose Zone Soil | VVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0137362_113701602 | 3300012205 | Vadose Zone Soil | AELTRRGVVLQGEFKTDEVHMIFTAPQTTFGVTLQLMEYKGRGKGA* |
Ga0137390_118184742 | 3300012363 | Vadose Zone Soil | LGGRGVVLEGGFETDEVRSIFTAPETTFGVALHLMEHTNRGTGQ* |
Ga0164301_101707994 | 3300012960 | Soil | WEGEVETDEVHFSVTAPQTTFGGTLQLMQHKGGGTGA* |
Ga0164308_114888261 | 3300012985 | Soil | GEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0164307_118364601 | 3300012987 | Soil | EFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0164306_109168712 | 3300012988 | Soil | LQGEVETDDVHFIFTAPQTTFGVTLQLMEHKGRGTGA* |
Ga0164305_102164383 | 3300012989 | Soil | LEGEVETDEVHFIFTAPQTTFGVTLQLMEHKGDGTGA* |
Ga0164305_104358161 | 3300012989 | Soil | AELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA* |
Ga0164305_120825011 | 3300012989 | Soil | AELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGGGTGA* |
Ga0157369_115692382 | 3300013105 | Corn Rhizosphere | LQGEFETDEVRSIFTAPQTTFGVTLHLMEYKGRGKGA* |
Ga0157374_113928061 | 3300013296 | Miscanthus Rhizosphere | ELTRRGVVLQGEFETDEVHSIFTAPETTFGVTLHLMEYKGRGKGA* |
Ga0182024_117765101 | 3300014501 | Permafrost | LQGEFKTDEVHSIFTAPQTTFGVTLHLMEHKDRGTGE* |
Ga0132258_138647292 | 3300015371 | Arabidopsis Rhizosphere | ELTRRGVILQGEFETDEVRSIFTAPQTTFGVTLHLMQYKGRGTGA* |
Ga0132256_1025846101 | 3300015372 | Arabidopsis Rhizosphere | GVVLQGEFKTDEVHSIFTAPQTTFGLTLQFTEYKGRGKGA* |
Ga0210403_112856471 | 3300020580 | Soil | GVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0210395_113204851 | 3300020582 | Soil | LEGEGKTDEVRWIFTAPETTFGLTLQFTQYLGRETGA |
Ga0210401_104788703 | 3300020583 | Soil | AELTHRGVVLQGEFETDEVHSIFTAPQTTFGVTLHLMEYKGRGKGA |
Ga0210401_106469512 | 3300020583 | Soil | RGVVLEGGFETDEVRSIFTAPETTFGVALHLMEHTNRGTGQ |
Ga0179596_101298422 | 3300021086 | Vadose Zone Soil | GEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0210404_100487792 | 3300021088 | Soil | GEFKTDEVHSIFTAPQTTFGLTLQFTEYKGRGKGA |
Ga0210405_106380151 | 3300021171 | Soil | VLQGEFETDEVHSIFTAPPTTFGVTLHLMEYKGRGKGA |
Ga0210405_109991211 | 3300021171 | Soil | AELTRRGVVLQGEFETDEVHSIFTAPQTTFGVTLHLMEYKGRGKGA |
Ga0210397_104776362 | 3300021403 | Soil | RGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0210389_105934741 | 3300021404 | Soil | AELTHRGVVWQGEFETDEVHSIFTAPQTTFGVTLHLMEYKGRGKGA |
Ga0210386_101627632 | 3300021406 | Soil | TRRGVVLQGEFKTDEVHSIFTVPETTFGLTLQFMKYKGRGTGE |
Ga0210384_109010411 | 3300021432 | Soil | RGVVLQGEFETDEVHSIFTAPQTTFGVTLHLMQYKGRGKGA |
Ga0210390_101446761 | 3300021474 | Soil | AKVELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0210390_110381481 | 3300021474 | Soil | VVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0210402_109708262 | 3300021478 | Soil | AELTRRGVVLQGEFKTDEVHSIFTAPQTTFGLTLQFTEYKGRGTGA |
Ga0210402_118399403 | 3300021478 | Soil | AELTRRGVVLQGEFETDEVRSVFTAPETTFGVTLHLMEHKGRGTGA |
Ga0210409_112106291 | 3300021559 | Soil | GVVLQGEYETDDVHYIFTAPETTFGVTLHLMEHKNRGTSE |
Ga0242665_102074291 | 3300022724 | Soil | RRGVVLQGEFKTDEVHMIFTAPQTTFGVTLQLMEHKGRGTGA |
Ga0247693_10643611 | 3300024181 | Soil | RRGVVLQGEFETDEVRSIFTVPETTFGVTLHLMEHKGRATGE |
Ga0207710_104847331 | 3300025900 | Switchgrass Rhizosphere | VVLQGERKTDEVHYIFTAPHTTFGVTLQLMQRKRRGTDD |
Ga0207699_102103673 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | KAELTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA |
Ga0207699_106157074 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0207693_1000283418 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA |
Ga0207693_103531263 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRRGVVLQGEFETDEVRSIFTAPQTTFGVTLHLMEYKGRGTGA |
Ga0207693_112641582 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTRRGVALEGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTGA |
Ga0207663_111433162 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVLQGEFETDEVRSIFTAPQTTFGVTLHLMEYKGRGKGA |
Ga0207687_109384331 | 3300025927 | Miscanthus Rhizosphere | GRGVVLEGGFETDEVRSIFTAPETTFGVALHLMEHTNRGTGQ |
Ga0207700_100777813 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0207664_100820947 | 3300025929 | Agricultural Soil | RGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0207664_107961913 | 3300025929 | Agricultural Soil | KAELTRRGVALEGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRGTGA |
Ga0209580_101796421 | 3300027842 | Surface Soil | RRGVVLQGEFETDEVRSVFTAPETTFGVTLHLMEHKGRGTGA |
Ga0209693_104580951 | 3300027855 | Soil | RGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRRTGA |
Ga0247675_10352781 | 3300028072 | Soil | AELTRRGVALQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0307504_104125871 | 3300028792 | Soil | QGEFKTDEVHSIFTVPETTFGVTLQLMEYKGRGKGA |
Ga0308309_106885161 | 3300028906 | Soil | TRQGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0222749_101577512 | 3300029636 | Soil | LQGEFKTDEVHSIFTAPQTTFGLTLQFTEYKGRGKGA |
Ga0170823_105787621 | 3300031128 | Forest Soil | VLLQGEYDTDDVHYIFTAPETTFGVTLHLMEHKNLGTGA |
Ga0307476_108345572 | 3300031715 | Hardwood Forest Soil | KAELTRRGVVLQGEFETDEVHSIFTAPQTTFGVTLHLMEYKGRGKGA |
Ga0307476_114430971 | 3300031715 | Hardwood Forest Soil | DDVHYIFTAPETTFGVTLHLMEHKDRGSGERAPRV |
Ga0307474_101976881 | 3300031718 | Hardwood Forest Soil | AELARRGVVLQGEFETDEVRSVFTAPETTFGVTLHLMEHKGRGTGA |
Ga0307474_107027881 | 3300031718 | Hardwood Forest Soil | LTRRGVVLQGEFETDEVRSVFTAPETTFGVTLHLMEHKGRRTGA |
Ga0307474_108272321 | 3300031718 | Hardwood Forest Soil | RRGVVLEGEGKTDEVHWIFTAPQTTFGLTLQFMEHKGRGTGA |
Ga0307469_106661871 | 3300031720 | Hardwood Forest Soil | RRGVLLEGEFETDEVHFIFTVPQTTFGVTLQLMEHKSRGTGA |
Ga0307469_110850221 | 3300031720 | Hardwood Forest Soil | LTRRGVLLEGEFETDEVHFIFTVPQTTFGVTLQLMEHKSRGTGA |
Ga0307477_104278341 | 3300031753 | Hardwood Forest Soil | RRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKVRGTGE |
Ga0307477_107017451 | 3300031753 | Hardwood Forest Soil | EGEGKTDEVHWIFTAPQTTFGVTLQLMEHKGRGTGA |
Ga0307475_110507361 | 3300031754 | Hardwood Forest Soil | GVLLEGEFETDEVHFIFTVPETTFGVTLQLMEHKSRGTGA |
Ga0307473_100774222 | 3300031820 | Hardwood Forest Soil | LEGEVETDEVHFIFTAPQTTFGVTLQLMEHKSRGTGA |
Ga0307473_104742703 | 3300031820 | Hardwood Forest Soil | QGEFETDEVRSVFTAPETTFGVTLHLMEHKSRGAGA |
Ga0307473_114419601 | 3300031820 | Hardwood Forest Soil | TRRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0307478_110809931 | 3300031823 | Hardwood Forest Soil | RRGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0307479_104364272 | 3300031962 | Hardwood Forest Soil | RRGVVLEGEVETDEVHFIFTAPQTTFGVTLQLMEHKGRVR |
Ga0307479_106347371 | 3300031962 | Hardwood Forest Soil | GEFETDEVRSVFTAPETTFGVTLHLMEHKGRGTGA |
Ga0307479_110522742 | 3300031962 | Hardwood Forest Soil | TRRGVVLEGEGKTDEVRWIFTAPQTTFGLTLQFMEHKGRGTGA |
Ga0307479_115067443 | 3300031962 | Hardwood Forest Soil | VVLQGEFETDEVRSIFTAPQTTFGVTLHLMEHKGGPARTTP |
Ga0307479_120712592 | 3300031962 | Hardwood Forest Soil | ELTRRGVVLQGEVETDEVHFIFTAPQTTFGVTLQLMEHKARGTGA |
Ga0307470_102636531 | 3300032174 | Hardwood Forest Soil | LARRGVFLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0307470_104110471 | 3300032174 | Hardwood Forest Soil | AELTRRGVLLEGEFETDEVHFIFTVPQTTFGVTLQLMEHKSRGTGA |
Ga0307470_105092413 | 3300032174 | Hardwood Forest Soil | VLQGEFETDEVRSIFTAPETTFGVTLHLMEYKGRGTGA |
Ga0307471_1007977961 | 3300032180 | Hardwood Forest Soil | RGVVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGCGTGA |
Ga0307472_1001234871 | 3300032205 | Hardwood Forest Soil | VVLQGEFETDEVRSIFTAPETTFGVTLHLMEHKGRGTGA |
Ga0373950_0136804_438_551 | 3300034818 | Rhizosphere Soil | LQGEFETDEVRSIFTAPQTTFGVTLHLMEHKGRATGE |
⦗Top⦘ |