NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069259

Metagenome / Metatranscriptome Family F069259

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069259
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 38 residues
Representative Sequence DLKTADHWVDQTLSTKKAKAEKQPGAQGITMDQPK
Number of Associated Samples 114
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 98.39 %
% of genes from short scaffolds (< 2000 bps) 88.71 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.258 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.871 % of family members)
Environment Ontology (ENVO) Unclassified
(26.613 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.419 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.75%    β-sheet: 0.00%    Coil/Unstructured: 68.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00535Glycos_transf_2 9.68
PF02786CPSase_L_D2 9.68
PF00289Biotin_carb_N 6.45
PF13231PMT_2 5.65
PF02597ThiS 3.23
PF02265S1-P1_nuclease 1.61
PF00639Rotamase 1.61
PF13462Thioredoxin_4 1.61
PF13649Methyltransf_25 1.61
PF01161PBP 0.81
PF00364Biotin_lipoyl 0.81
PF04536TPM_phosphatase 0.81
PF12867DinB_2 0.81
PF02423OCD_Mu_crystall 0.81
PF13751DDE_Tnp_1_6 0.81
PF11954DUF3471 0.81
PF14534DUF4440 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 3.23
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 3.23
COG0760Peptidyl-prolyl isomerase, parvulin familyPosttranslational modification, protein turnover, chaperones [O] 1.61
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.81
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.26 %
UnclassifiedrootN/A17.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101CVDENAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis507Open in IMG/M
3300001356|JGI12269J14319_10290247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300002568|C688J35102_118464327All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300005181|Ga0066678_10194600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1292Open in IMG/M
3300005435|Ga0070714_100315743All Organisms → cellular organisms → Bacteria → Acidobacteria1460Open in IMG/M
3300005541|Ga0070733_10614823All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300005542|Ga0070732_10504890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae732Open in IMG/M
3300005554|Ga0066661_10775316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300005587|Ga0066654_10626981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300005602|Ga0070762_10133022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1473Open in IMG/M
3300005610|Ga0070763_10014068All Organisms → cellular organisms → Bacteria3384Open in IMG/M
3300005618|Ga0068864_100205984All Organisms → cellular organisms → Bacteria → Acidobacteria1809Open in IMG/M
3300005712|Ga0070764_10427930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter786Open in IMG/M
3300005891|Ga0075283_1052751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter703Open in IMG/M
3300005921|Ga0070766_10912598All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300006034|Ga0066656_10007615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium5306Open in IMG/M
3300006034|Ga0066656_10907698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300006162|Ga0075030_101658718All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300006173|Ga0070716_100433498All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300006755|Ga0079222_12136073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300006800|Ga0066660_10209837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1493Open in IMG/M
3300006893|Ga0073928_10303540All Organisms → cellular organisms → Bacteria → Acidobacteria1198Open in IMG/M
3300009089|Ga0099828_11812837All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300009176|Ga0105242_11199929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300009522|Ga0116218_1201015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300009552|Ga0116138_1197224Not Available556Open in IMG/M
3300009639|Ga0116122_1165074Not Available701Open in IMG/M
3300009646|Ga0116132_1250577Not Available539Open in IMG/M
3300009665|Ga0116135_1202041Not Available759Open in IMG/M
3300010046|Ga0126384_10485530Not Available1062Open in IMG/M
3300010048|Ga0126373_11755845All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300010048|Ga0126373_12647331All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300010336|Ga0134071_10106182All Organisms → cellular organisms → Bacteria → Acidobacteria1338Open in IMG/M
3300010343|Ga0074044_10430996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300010358|Ga0126370_11335850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300010361|Ga0126378_12976363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300010366|Ga0126379_10826083All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300010366|Ga0126379_11537842All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300010376|Ga0126381_101862193Not Available868Open in IMG/M
3300010398|Ga0126383_13258839All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300011269|Ga0137392_10552382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium956Open in IMG/M
3300012201|Ga0137365_11200962All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiodictyon → Candidatus Thiodictyon syntrophicum542Open in IMG/M
3300012212|Ga0150985_121583293All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300012955|Ga0164298_10267804All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1040Open in IMG/M
3300014165|Ga0181523_10701764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300014657|Ga0181522_10013319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4441Open in IMG/M
3300014657|Ga0181522_10371504All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300014969|Ga0157376_12051305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300015372|Ga0132256_100666423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300017928|Ga0187806_1136923Not Available801Open in IMG/M
3300017936|Ga0187821_10029492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1935Open in IMG/M
3300017942|Ga0187808_10352855Not Available668Open in IMG/M
3300017972|Ga0187781_10497785Not Available875Open in IMG/M
3300017975|Ga0187782_10364108All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300018009|Ga0187884_10296484Not Available654Open in IMG/M
3300018026|Ga0187857_10535459Not Available524Open in IMG/M
3300018033|Ga0187867_10430725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae729Open in IMG/M
3300018038|Ga0187855_10765432Not Available563Open in IMG/M
3300018040|Ga0187862_10066502All Organisms → cellular organisms → Bacteria → Acidobacteria2574Open in IMG/M
3300018040|Ga0187862_10758472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae564Open in IMG/M
3300018042|Ga0187871_10487320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300018046|Ga0187851_10798966Not Available531Open in IMG/M
3300018047|Ga0187859_10493930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae681Open in IMG/M
3300018064|Ga0187773_10992474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300018085|Ga0187772_11284394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300018086|Ga0187769_11016361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300018431|Ga0066655_10895930All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300019786|Ga0182025_1271982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis532Open in IMG/M
3300019999|Ga0193718_1032546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300020581|Ga0210399_11164904Not Available614Open in IMG/M
3300021088|Ga0210404_10497388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300021181|Ga0210388_10199933All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1749Open in IMG/M
3300021401|Ga0210393_10085732All Organisms → cellular organisms → Bacteria2498Open in IMG/M
3300021406|Ga0210386_11260416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300021420|Ga0210394_10177027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1857Open in IMG/M
3300021476|Ga0187846_10358749All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300021560|Ga0126371_11242659All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300022734|Ga0224571_101818All Organisms → cellular organisms → Bacteria → Acidobacteria1343Open in IMG/M
3300022881|Ga0224545_1008018All Organisms → cellular organisms → Bacteria → Acidobacteria1655Open in IMG/M
3300024225|Ga0224572_1080417All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300025899|Ga0207642_10170363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1177Open in IMG/M
3300025906|Ga0207699_10116904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1718Open in IMG/M
3300025916|Ga0207663_10990862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300025924|Ga0207694_10195478All Organisms → cellular organisms → Bacteria → Acidobacteria1644Open in IMG/M
3300025934|Ga0207686_10666621All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300025934|Ga0207686_11125676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300026324|Ga0209470_1095983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1337Open in IMG/M
3300026334|Ga0209377_1041394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2118Open in IMG/M
3300026499|Ga0257181_1033078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300026552|Ga0209577_10130361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2002Open in IMG/M
3300026557|Ga0179587_10956868All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300027070|Ga0208365_1024305All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300027727|Ga0209328_10178633All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300027824|Ga0209040_10268645Not Available846Open in IMG/M
3300027862|Ga0209701_10224561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1109Open in IMG/M
3300027898|Ga0209067_10448722All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300027905|Ga0209415_10038312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6581Open in IMG/M
3300027905|Ga0209415_10679710All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300027908|Ga0209006_11066582All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300028773|Ga0302234_10531008Not Available503Open in IMG/M
3300028906|Ga0308309_10730552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium860Open in IMG/M
3300029636|Ga0222749_10679379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4563Open in IMG/M
3300029955|Ga0311342_10274251Not Available1554Open in IMG/M
3300029984|Ga0311332_10045454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3061Open in IMG/M
3300030617|Ga0311356_11800050Not Available546Open in IMG/M
3300030618|Ga0311354_11334681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300030737|Ga0302310_10313276All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium879Open in IMG/M
3300030743|Ga0265461_13103124Not Available559Open in IMG/M
3300031128|Ga0170823_10517198All Organisms → cellular organisms → Bacteria → Acidobacteria1195Open in IMG/M
3300031715|Ga0307476_10022829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4085Open in IMG/M
3300031754|Ga0307475_10631757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300031754|Ga0307475_11150484All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031769|Ga0318526_10066296All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300031954|Ga0306926_12567473All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032035|Ga0310911_10026661All Organisms → cellular organisms → Bacteria2846Open in IMG/M
3300032174|Ga0307470_10037823All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2362Open in IMG/M
3300032180|Ga0307471_100001151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis14314Open in IMG/M
3300032180|Ga0307471_102871248Not Available612Open in IMG/M
3300032180|Ga0307471_103215848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300032205|Ga0307472_101808897Not Available607Open in IMG/M
3300032783|Ga0335079_11730897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300032805|Ga0335078_11402455All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300034124|Ga0370483_0032585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1590Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.06%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.26%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.03%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.23%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.23%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.23%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.81%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.81%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022734Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3Host-AssociatedOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_065061602189573001Grass SoilRRIYKTADEWVDKTMANQKAKAEKQPGAGGIVMDQNK
JGI12269J14319_1029024723300001356Peatlands SoilEDLKTADHWSDEVMRVRKAKAEKAAQSQGGGITIDQPK*
C688J35102_11846432723300002568SoilRTEDLKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSK*
Ga0066678_1019460023300005181SoilPAARAADLKTADEWVDKTLDVKKHKAEKQPGAQGITMDQNK*
Ga0070714_10031574313300005435Agricultural SoilTEDLKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSK*
Ga0070733_1061482323300005541Surface SoilDDLNARQQDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK*
Ga0070732_1050489033300005542Surface SoilAADLKTADEWVDKTLAVKKAKAEKQPGAGGITMGNEGK*
Ga0066661_1077531613300005554SoilECDDLSARAEDLKTADHWVDETLRVKKEKADKAAQNPGGITVDQPK*
Ga0066654_1062698113300005587SoilADQRAADLKTADEWVDKAMAAKRAKAEKAANSPQGITVDQSK*
Ga0070762_1013302213300005602SoilAARQEDLKTADHWVDQTLITKKIKSEKQPGTQGITMDQPK*
Ga0070763_1001406853300005610SoilRQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK*
Ga0068864_10020598433300005618Switchgrass RhizosphereDLKTADEWVDKTMAAKKAKAEKQTGANGITMDQSK*
Ga0070764_1042793013300005712SoilADLKSADEWVDKTMATKKAKAEKQPGQQGITMDQPK*
Ga0075283_105275123300005891Rice Paddy SoilLKTADEWVDKTMATKKANAEKQGQGGIVLDQKQQ*
Ga0070766_1091259813300005921SoilARQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQPK*
Ga0066656_1000761513300006034SoilLKTADEWVDKTLDVKKHKAEKQPGAQGITMDQNK*
Ga0066656_1090769823300006034SoilDLKTADHWVDETLRVKKAKAEKAAQSQGGGITVDQPK*
Ga0075030_10165871813300006162WatershedsDLKTADEWVDKTLAVKKAKAEKQPGAQGITMEQK*
Ga0070716_10043349823300006173Corn, Switchgrass And Miscanthus RhizosphereTEDLKTADHWVDETLRIKKAKAEKAAQSQGGGITMDQTK*
Ga0079222_1213607333300006755Agricultural SoilADQRAADLKTADEWVDKAMAAKKAKAEKAANSPQGITVDQSK*
Ga0066660_1020983733300006800SoilLKEADTWVDKTMATKKAKAEKQPGAQGVTMDQPSK*
Ga0073928_1030354013300006893Iron-Sulfur Acid SpringEDLKTADHWVDQTLITKKAKAEKQPGQQQGITLDQPK*
Ga0099828_1181283713300009089Vadose Zone SoilADLKTADEWVDKTMAVKKAKAEKQPSNTGITMDQNK*
Ga0105242_1119992923300009176Miscanthus RhizosphereDTKKADDYVDQAMAVKKARAEKQPGAQGIVMDQPK*
Ga0116218_120101523300009522Peatlands SoilKNADEWVDKTMATKKAKAERQPSNNGITMDQNSQ*
Ga0116138_119722423300009552PeatlandLNVRREDLKTANDWVDQALLTRNVKAEKQPWQQGMTMDQSK*
Ga0116122_116507423300009639PeatlandGDLKTADDWVDQTLLTKKAKAEKQPGQQRMTMDQSK*
Ga0116132_125057713300009646PeatlandDLKTADDWVDQTLLTKKAKAEKQPGQQRMTMDQSK*
Ga0116135_120204113300009665PeatlandLKTADHWVDQTLITKKVKAEKQPGANGITMDQPK*
Ga0126384_1048553023300010046Tropical Forest SoilADLKTADQWVDKTLEVKKAKAAKQPGAGGITMDQQK*
Ga0126373_1175584523300010048Tropical Forest SoilESARAEDLKTADHWVDETMRVKKAKAEKAAQAQGGGITMDSSK*
Ga0126373_1264733123300010048Tropical Forest SoilEDLKTADGWVDKTLATKKLKAEKAAQSQGGQITMDQSK*
Ga0134071_1010618213300010336Grasslands SoilLKTADEWVDKTMAAKKAKAEKQPGAQGITMQPSQ*
Ga0074044_1043099613300010343Bog Forest SoilDLAARQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQPK*
Ga0126370_1133585023300010358Tropical Forest SoilAEDLKAADHWVDETLRVKKAKAEKAAQSQGGGITMEPK*
Ga0126378_1297636313300010361Tropical Forest SoilDLKKADEWVDKTMATKKAKAEKQPGTQGIVMDQQK*
Ga0126379_1082608323300010366Tropical Forest SoilEAARAEDLKSADHWVDETMRVKKAKAEKAAQAQGGGITMDSSK*
Ga0126379_1153784223300010366Tropical Forest SoilKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQPTK*
Ga0126381_10186219313300010376Tropical Forest SoilQAAADLKTADAWQDKTLDARKRKAEKQAAPQGVSMDDSGK*
Ga0126383_1325883913300010398Tropical Forest SoilKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSSK*
Ga0137392_1055238213300011269Vadose Zone SoilRAEDLKTAERWVDQTLLTKKAKAEKQPGQQGITADQPK*
Ga0137365_1120096213300012201Vadose Zone SoilDDLAARAEDLKTADHWVDETLRVKKAKAEKAAQGQGGGITVDQPK*
Ga0150985_12158329313300012212Avena Fatua RhizosphereKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSK*
Ga0164298_1026780413300012955SoilADLKTADEWVDKTMATKKAKAEKQPGNQGITMPSK*
Ga0181523_1070176423300014165BogADQKAADNWVDKTLATKKAKADKAAAAAGGGITVDQK*
Ga0181522_1001331913300014657BogDLKTADHWVDETLITKKAKAEKQPGTQGITMDQPK*
Ga0181522_1037150423300014657BogLKTADHWVDETLRVKKAKAEKAAQSQGGGITVDTPK*
Ga0157376_1205130513300014969Miscanthus RhizosphereTADHWVDETLRVKKAKAEKAAQSQGGGITMDQPK*
Ga0132256_10066642323300015372Arabidopsis RhizosphereLKTADEWVDKTMATKKAKAEKQPGTTGIVNEQSK*
Ga0187806_113692313300017928Freshwater SedimentDLKTADEWVDKTMAAKRAKVEKQAAAPGGISLDQPK
Ga0187821_1002949223300017936Freshwater SedimentADLKTADEWVDKTMAVKKAKAEKQPGNQGITMPSQ
Ga0187808_1035285533300017942Freshwater SedimentAADLKTADEWVDKTMAAKRAKAEKQAAAPGGISLDQPK
Ga0187781_1049778513300017972Tropical PeatlandQKDLKEADHWVDQTLITKKIKAEKQPGAQGITLDQPK
Ga0187782_1036410813300017975Tropical PeatlandAARTEDLKAADHWVDETMRVKKANAEKAAAAQGGGITVDQPTK
Ga0187884_1029648413300018009PeatlandRREDLKTADDWVDQALLTRNVKAEKQPWQQGMTMDQSK
Ga0187857_1053545923300018026PeatlandRQEDLKTADQWVDKTLSTKKAKAEKQPGAQGITMDQPK
Ga0187867_1043072513300018033PeatlandREDLKTADYWVDQTLLTKKAKAEKQPGQQGITMHQPK
Ga0187855_1076543223300018038PeatlandQEDLKTADHWVDQTLITKKAKAEKQPGPQGITMDQPK
Ga0187862_1006650233300018040PeatlandLNQRQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITLDQPK
Ga0187862_1075847213300018040PeatlandDLKTADQWVDKTLSTKKAKAEKQPGTNGITMDQPK
Ga0187871_1048732013300018042PeatlandAARQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQQK
Ga0187851_1079896613300018046PeatlandTRQEDLKTADQWVDKTLSTKKAKAEKQPGAQGITMDQPK
Ga0187859_1049393033300018047PeatlandARREDLKTADYWVDQTLLTKKAKAEKQPGQQGITMHQPK
Ga0187773_1099247413300018064Tropical PeatlandADEWVDKTMATKKAKAAKQAGPGGIVLEQPQTPQQ
Ga0187772_1128439423300018085Tropical PeatlandKTADHWVDETLRVKKAKADKAAQSSGGGITVDQPK
Ga0187769_1101636113300018086Tropical PeatlandDLAARQEDLKTADHWVDQTLITKKAKAEKQPGQQGGITMDQPK
Ga0066655_1089593023300018431Grasslands SoilSARAGDLKTADHWVDEALRVKKEKADKGAQNPCGITVDQPK
Ga0182025_127198213300019786PermafrostQEDLKTADQWVDKTLSTKKAKAEKQPGTNGITMDQPK
Ga0193718_103254623300019999SoilTADLKTADEWVDKTLAVKKAKAEKQPGNQGLTTESPK
Ga0210399_1116490423300020581SoilADLKTADEWLDKTMAAKRAKAEKQAAAPGGISLDQPK
Ga0210404_1049738823300021088SoilAADLKAADEWVDKTLAVKKAKAEKQPGATGITMENK
Ga0210388_1019993323300021181SoilAADLKTADEWVDKTMAIKKAKAEKQPGGGGIVLDKQ
Ga0210393_1008573243300021401SoilRQADLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQPK
Ga0210386_1126041613300021406SoilRAEDLKTADHWVDETLRVKKAKAEKAAQSQTGGITLDAPKQ
Ga0210394_1017702723300021420SoilDLKTADHWVDQTLSTKKAKAEKQPGAQGITMDQPK
Ga0187846_1035874913300021476BiofilmPSARSADLKAADEWVDKTLAVKKAKAEKQPGAAGITMDQGK
Ga0126371_1124265913300021560Tropical Forest SoilKSADHWVDETMRVKKAKAEKAAQAQGGGITMDSSK
Ga0224571_10181823300022734RhizosphereNQRQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITLDQPK
Ga0224545_100801813300022881SoilPASRQEDLKTADQWVDKTLSTKKAKAEKQPGAQGITMDQPK
Ga0224572_108041723300024225RhizosphereDDLAARAEDLKTADHWVDETLRVKKAKAEKAAQSQGGGIVMDK
Ga0207642_1017036313300025899Miscanthus RhizosphereDLKTADEWVDKTMAAKKAKAEKQTGANGITMDQSK
Ga0207699_1011690413300025906Corn, Switchgrass And Miscanthus RhizosphereADLKTADEWVDKTLATKKEKAAKQPGAQGVTLDQPSK
Ga0207663_1099086213300025916Corn, Switchgrass And Miscanthus RhizosphereTADDWVDKTMATKKAKAEKQPGAQGITLGGDSSSK
Ga0207694_1019547823300025924Corn RhizosphereQRVADSKTADEWVDKTLAAKKAKAEKSAGPNGITMSK
Ga0207686_1066662113300025934Miscanthus RhizosphereDTKKADDYVDQAMAVKKARAEKQPGAQGIVMDQPK
Ga0207686_1112567623300025934Miscanthus RhizosphereADLKTADEWVDKTMATKKAKAEKQPGNQGITMPSK
Ga0209470_109598313300026324SoilADLKTADEWVDKTMAAKKAKAEKQPGAQGITMQPSQ
Ga0209377_104139433300026334SoilAADLKTADEWVDKTMAAKKAKAEKQPGAQGITMQPSQSPSQ
Ga0257181_103307823300026499SoilDLAARAEDLKTADHWVDQTLLTKKAKAEKQPGQQGITADQPK
Ga0209805_110480013300026542SoilKTADEWVEKTMATKRAKAEKQNKAAGIVVEQGQSQSK
Ga0209577_1013036143300026552SoilLKEADTWVDKTMATKKAKAEKQPGAQGVTMDQPSK
Ga0179587_1095686813300026557Vadose Zone SoilNARQEDLKTADHWVDQTLSTKKAKAEKQPGQQGITMDQPK
Ga0208365_102430523300027070Forest SoilARQEDLKTADHWVDQTLITKKAKAEKQPGQQQGITLDQPK
Ga0209328_1017863323300027727Forest SoilARAEDLKTADHWVDETLRVKKAKAEKAAQNSQGGITVDKQ
Ga0209040_1026864523300027824Bog Forest SoilARQEDLKTADHWVDQTLLTKKAKAEKQPGNQGITMDQPK
Ga0209701_1022456113300027862Vadose Zone SoilRAADLKTADEWVDKTMTTKKIKAEKQPGNQGITMPSK
Ga0209067_1044872223300027898WatershedsLSARAEDLKTADHWVDETLRVKKAKAEKAAQSAQGGITVDQK
Ga0209415_1003831213300027905Peatlands SoilLKTADHWVDETLRVKKAKAEKAAEKAAGGITMDQSK
Ga0209415_1067971023300027905Peatlands SoilHPGAEDLKTADHWVDETLRVKKARADKAAQSTGGGITMDTPK
Ga0209006_1106658223300027908Forest SoilSDLKTADDWVDKTMAAKKAKAEKQPGVQGITLDQNASGNK
Ga0302234_1053100813300028773PalsaARQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK
Ga0308309_1073055223300028906SoilDDLNARQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK
Ga0222749_1067937923300029636SoilQEDLKTADHWVDRTLSTKKAKAEKQPGTQGITMDQPK
Ga0311342_1027425123300029955BogRQEDLKTADTWVDKTLSTKKAKAEKQPGTQGITLDQPK
Ga0311332_1004545413300029984FenDLKTADEWVDKTMAVKKMKAEKQPVGGGIVMDQKQ
Ga0311356_1180005023300030617PalsaDLAARQEDLKTADHWVDQTLITKKAKAEKQPGTQGITMDQPK
Ga0311354_1133468113300030618PalsaARQEDLKTADHWVDQTLLTKKIKSEKQPGATGITMDQPK
Ga0302310_1031327613300030737PalsaEDLKTADHWVDQTLLTKKVKAEKQPGQQGITMDQPK
Ga0265461_1310312413300030743SoilQEDLKTADHWVDQTLLTKKAKAEKQPGNQGITMDQSK
Ga0170823_1051719813300031128Forest SoilFARQEDLKAADGWVDKTLATKKAKAEKQPGTNGITLDQPK
Ga0307476_1002282913300031715Hardwood Forest SoilRTEDLKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQPK
Ga0307475_1063175713300031754Hardwood Forest SoilLKTADEWVDKTMATKKAKAEKQPGAQGITMDQQSK
Ga0307475_1115048413300031754Hardwood Forest SoilADLKTADEWVDKTLAVKKAKAEKQPGAGGITMGNEGK
Ga0318526_1006629633300031769SoilDLKTADEWVDRTLAVKKAKAEKQPGAAGITMDQGK
Ga0306926_1256747323300031954SoilDLKTADEWVDKTMAAKKAKAEKQSGAQGITLDQSK
Ga0310911_1002666153300032035SoilRAADLKTADEWVDRTLAVKKAKAEKQPGAAGITMDQGK
Ga0307470_1003782333300032174Hardwood Forest SoilRAEDLKTADHWVDETLRVKKAKAEKAAQSAGGGITVDQPK
Ga0307471_100001151163300032180Hardwood Forest SoilAADMKTADEWVDKTMATKKAKAEKQPGAQGITMPSQ
Ga0307471_10287124823300032180Hardwood Forest SoilAARQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK
Ga0307471_10321584813300032180Hardwood Forest SoilAADLKTADEWVDKTMATKKIKAEKQPGAQGITLDQPK
Ga0307472_10180889723300032205Hardwood Forest SoilRAADLKTADEWVDKTMAAKKAKAQKQTGNQGITLDQPK
Ga0335079_1173089723300032783SoilADLKTADEWVDKTMATKKAKAEKQPGAQGITMDQPAGK
Ga0335078_1140245523300032805SoilRADDLKTADHWVDETLRVKKAKADKAAQAAQGGITVDQSK
Ga0370483_0032585_1475_15883300034124Untreated Peat SoilQEDLKTADHWVDQTLITKKAKAEKQPGTQGITMDQPK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.