Metagenome Family F069517

Basic Information
Family ID	F069517
Family Type	Metagenome
Number of Sequences	123
Average Sequence Length	40 residues
Representative Sequence	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Number of Associated Samples	22
Number of Associated Scaffolds	123

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	73.17 %
% of genes near scaffold ends (potentially truncated)	14.63 %
% of genes from short scaffolds (< 2000 bps)	49.59 %
Associated GOLD sequencing projects	22
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Eukaryota (63.415 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (65.854 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (75.610 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 123 Family Scaffolds
PF00078	RVT_1	4.07
PF07727	RVT_2	1.63
PF01535	PPR	0.81
PF14244	Retrotran_gag_3	0.81
PF14223	Retrotran_gag_2	0.81
PF13833	EF-hand_8	0.81
PF00249	Myb_DNA-binding	0.81
PF02992	Transposase_21	0.81
PF08284	RVP_2	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.41 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.41 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	63.41 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	61.79 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	61.79 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	61.79 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	61.79 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	57.72 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	57.72 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	57.72 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	57.72 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	52.03 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	52.03 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	52.03 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	52.03 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	52.03 %
Unclassified	root	N/A	36.59 %

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	51.22 %
Unclassified	root	N/A	36.59 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.81 %

Name	Rank	Taxonomy	Distribution
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	51.22 %
Unclassified	root	N/A	36.59 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.81 %

Name	Rank	Taxonomy	Distribution
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	51.22 %
Unclassified	root	N/A	36.59 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	51.22 %
Unclassified	root	N/A	36.59 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.81 %

Name	Rank	Taxonomy	Distribution
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	47.15 %
Unclassified	root	N/A	36.59 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.81 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.81 %

Name	Rank	Taxonomy	Distribution
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	43.09 %
Unclassified	root	N/A	36.59 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1.63 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.81 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.81 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10010093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13269	Open in IMG/M
3300028786\|Ga0307517_10072376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	3073	Open in IMG/M
3300028786\|Ga0307517_10093516	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2436	Open in IMG/M
3300028786\|Ga0307517_10100361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2286	Open in IMG/M
3300028786\|Ga0307517_10105012	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2195	Open in IMG/M
3300028786\|Ga0307517_10127154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1854	Open in IMG/M
3300028786\|Ga0307517_10162213	Not Available	1496	Open in IMG/M
3300028786\|Ga0307517_10182437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1351	Open in IMG/M
3300028786\|Ga0307517_10183903	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1342	Open in IMG/M
3300028786\|Ga0307517_10257343	Not Available	1017	Open in IMG/M
3300028786\|Ga0307517_10279280	Not Available	953	Open in IMG/M
3300028786\|Ga0307517_10305875	Not Available	888	Open in IMG/M
3300028786\|Ga0307517_10375090	Not Available	762	Open in IMG/M
3300028786\|Ga0307517_10386003	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	746	Open in IMG/M
3300028786\|Ga0307517_10438943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	679	Open in IMG/M
3300028794\|Ga0307515_10006711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	22923	Open in IMG/M
3300028794\|Ga0307515_10013004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	15592	Open in IMG/M
3300028794\|Ga0307515_10030111	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	9136	Open in IMG/M
3300028794\|Ga0307515_10052087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6081	Open in IMG/M
3300028794\|Ga0307515_10077767	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4375	Open in IMG/M
3300028794\|Ga0307515_10086924	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3977	Open in IMG/M
3300028794\|Ga0307515_10133477	Not Available	2716	Open in IMG/M
3300028794\|Ga0307515_10167282	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2209	Open in IMG/M
3300028794\|Ga0307515_10253590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1507	Open in IMG/M
3300028794\|Ga0307515_10277520	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1387	Open in IMG/M
3300028794\|Ga0307515_10290628	Not Available	1330	Open in IMG/M
3300028794\|Ga0307515_10352060	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1118	Open in IMG/M
3300028794\|Ga0307515_10474084	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	864	Open in IMG/M
3300028794\|Ga0307515_10518557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	801	Open in IMG/M
3300028794\|Ga0307515_10805038	Not Available	562	Open in IMG/M
3300030521\|Ga0307511_10126778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1553	Open in IMG/M
3300030521\|Ga0307511_10244481	Not Available	870	Open in IMG/M
3300030521\|Ga0307511_10267217	Not Available	804	Open in IMG/M
3300030521\|Ga0307511_10279324	Not Available	773	Open in IMG/M
3300030521\|Ga0307511_10408458	Not Available	554	Open in IMG/M
3300030521\|Ga0307511_10428666	Not Available	531	Open in IMG/M
3300030522\|Ga0307512_10047493	Not Available	3489	Open in IMG/M
3300030522\|Ga0307512_10106171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1875	Open in IMG/M
3300030522\|Ga0307512_10111396	Not Available	1801	Open in IMG/M
3300030522\|Ga0307512_10269013	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	827	Open in IMG/M
3300030522\|Ga0307512_10352969	Not Available	646	Open in IMG/M
3300030522\|Ga0307512_10422690	Not Available	549	Open in IMG/M
3300031456\|Ga0307513_10021291	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7656	Open in IMG/M
3300031456\|Ga0307513_10213625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1758	Open in IMG/M
3300031456\|Ga0307513_10290866	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1405	Open in IMG/M
3300031456\|Ga0307513_10443793	Not Available	1023	Open in IMG/M
3300031456\|Ga0307513_10458805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	997	Open in IMG/M
3300031456\|Ga0307513_10474156	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	972	Open in IMG/M
3300031456\|Ga0307513_10519237	Not Available	906	Open in IMG/M
3300031456\|Ga0307513_10766153	Not Available	670	Open in IMG/M
3300031507\|Ga0307509_10037092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5330	Open in IMG/M
3300031507\|Ga0307509_10172964	Not Available	2036	Open in IMG/M
3300031507\|Ga0307509_10235114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1631	Open in IMG/M
3300031507\|Ga0307509_10425496	Not Available	1027	Open in IMG/M
3300031507\|Ga0307509_10822056	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	593	Open in IMG/M
3300031507\|Ga0307509_10981212	Not Available	511	Open in IMG/M
3300031616\|Ga0307508_10077792	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	2896	Open in IMG/M
3300031616\|Ga0307508_10127833	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2144	Open in IMG/M
3300031616\|Ga0307508_10294020	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1217	Open in IMG/M
3300031616\|Ga0307508_10297943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1205	Open in IMG/M
3300031616\|Ga0307508_10312873	Not Available	1162	Open in IMG/M
3300031616\|Ga0307508_10664835	Not Available	648	Open in IMG/M
3300031649\|Ga0307514_10025749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4759	Open in IMG/M
3300031649\|Ga0307514_10120790	Not Available	1828	Open in IMG/M
3300031649\|Ga0307514_10330636	Not Available	828	Open in IMG/M
3300031649\|Ga0307514_10435676	Not Available	651	Open in IMG/M
3300031649\|Ga0307514_10573329	Not Available	514	Open in IMG/M
3300031730\|Ga0307516_10392582	Not Available	1047	Open in IMG/M
3300031730\|Ga0307516_10419236	Not Available	996	Open in IMG/M
3300031838\|Ga0307518_10090297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2204	Open in IMG/M
3300031838\|Ga0307518_10210782	Not Available	1279	Open in IMG/M
3300031838\|Ga0307518_10383457	Not Available	795	Open in IMG/M
3300031838\|Ga0307518_10470316	Not Available	662	Open in IMG/M
3300032354\|Ga0325403_1000236	Not Available	34390	Open in IMG/M
3300032354\|Ga0325403_1001992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17721	Open in IMG/M
3300032354\|Ga0325403_1005400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12049	Open in IMG/M
3300032354\|Ga0325403_1007316	Not Available	10548	Open in IMG/M
3300032354\|Ga0325403_1008121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10045	Open in IMG/M
3300032354\|Ga0325403_1009961	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	9062	Open in IMG/M
3300032354\|Ga0325403_1011045	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	8578	Open in IMG/M
3300032354\|Ga0325403_1011938	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8222	Open in IMG/M
3300032354\|Ga0325403_1013912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7559	Open in IMG/M
3300032354\|Ga0325403_1015204	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7190	Open in IMG/M
3300032354\|Ga0325403_1017671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6574	Open in IMG/M
3300032354\|Ga0325403_1018897	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6311	Open in IMG/M
3300032354\|Ga0325403_1023630	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5439	Open in IMG/M
3300032354\|Ga0325403_1027766	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4842	Open in IMG/M
3300032354\|Ga0325403_1032351	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4319	Open in IMG/M
3300032354\|Ga0325403_1036836	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3878	Open in IMG/M
3300032354\|Ga0325403_1040611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3572	Open in IMG/M
3300032354\|Ga0325403_1041551	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	3497	Open in IMG/M
3300032354\|Ga0325403_1044805	All Organisms → cellular organisms → Eukaryota	3264	Open in IMG/M
3300032354\|Ga0325403_1060400	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2384	Open in IMG/M
3300032354\|Ga0325403_1101243	Not Available	1162	Open in IMG/M
3300032355\|Ga0325401_1000650	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	26276	Open in IMG/M
3300032355\|Ga0325401_1014400	All Organisms → cellular organisms → Eukaryota	7560	Open in IMG/M
3300032374\|Ga0325400_1005160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	12246	Open in IMG/M
3300032374\|Ga0325400_1036836	Not Available	4303	Open in IMG/M
3300032374\|Ga0325400_1040807	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4003	Open in IMG/M
3300032389\|Ga0325405_1000245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	51429	Open in IMG/M
3300032389\|Ga0325405_1009673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	9408	Open in IMG/M
3300032389\|Ga0325405_1024333	Not Available	5064	Open in IMG/M
3300032389\|Ga0325405_1024561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	5018	Open in IMG/M
3300032389\|Ga0325405_1029615	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4287	Open in IMG/M
3300032389\|Ga0325405_1072023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1505	Open in IMG/M
3300032389\|Ga0325405_1106891	Not Available	769	Open in IMG/M
3300032390\|Ga0325404_1001975	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21827	Open in IMG/M
3300032390\|Ga0325404_1069623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1505	Open in IMG/M
3300032735\|Ga0325410_1010643	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	9643	Open in IMG/M
3300032740\|Ga0325411_1021793	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	5798	Open in IMG/M
3300032741\|Ga0325414_1002878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	17720	Open in IMG/M
3300033179\|Ga0307507_10032821	Not Available	5408	Open in IMG/M
3300033179\|Ga0307507_10071263	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3144	Open in IMG/M
3300033179\|Ga0307507_10085985	Not Available	2731	Open in IMG/M
3300033179\|Ga0307507_10150220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1755	Open in IMG/M
3300033179\|Ga0307507_10282413	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1036	Open in IMG/M
3300033180\|Ga0307510_10184298	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1645	Open in IMG/M
3300033180\|Ga0307510_10314249	Not Available	1025	Open in IMG/M
3300033180\|Ga0307510_10392087	Not Available	832	Open in IMG/M
3300034389\|Ga0325419_003787	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	16978	Open in IMG/M
3300034389\|Ga0325419_004796	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	15025	Open in IMG/M
3300034389\|Ga0325419_009035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	10592	Open in IMG/M
3300034778\|Ga0325423_023794	Not Available	5064	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	65.85%
Wood	Host-Associated → Plants → Wood	30.08%
Phylloplane	Host-Associated → Plants → Phylloplane	4.06%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	65.85%
Unclassified	Host-Associated → Plants → Wood → Unclassified	30.08%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	4.06%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	65.85%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	30.08%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	4.06%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	65.85%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	30.08%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	4.06%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated	Open in IMG/M
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated	Open in IMG/M
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M
3300034778	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_1001009322	3300028786	Ectomycorrhiza	MRIISNLCEITGIIILLTKKVSRMLDNSYGIIGLILETKMDWPDFLGN
Ga0307517_100723764	3300028786	Ectomycorrhiza	MRIIGNLCEITGITIWLTKEVSRMLGNSYGITELILATKIG
Ga0307517_100935161	3300028786	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307517_101003614	3300028786	Ectomycorrhiza	MKIIGNLREITEIIWLTKEVSQVLGNSYGITRLIVATKMG
Ga0307517_101050122	3300028786	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITELIVATKMG
Ga0307517_101271541	3300028786	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSQVLGNSYGITGLIVATKTG
Ga0307517_101622132	3300028786	Ectomycorrhiza	MRIIGNLCEIIGITIWLTKEVSWMLDNSYGITELILATKIG
Ga0307517_101824371	3300028786	Ectomycorrhiza	MIIIGILREITKIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307517_101839031	3300028786	Ectomycorrhiza	MRIIGNLREITKIIWLTKEVSRVLGNSYGITGLIVANKMG
Ga0307517_102573432	3300028786	Ectomycorrhiza	MRIIGNLSEITEIIWLTKELSRVLGNSYGITGLIG
Ga0307517_102792801	3300028786	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGKLYGITGLIVATKMG
Ga0307517_103058752	3300028786	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSWVLGNSYGITGLIVATKMG
Ga0307517_103750901	3300028786	Ectomycorrhiza	QMIIIGNLREITKIIWLTKEVSRVLGNSYGITGLIG
Ga0307517_103860031	3300028786	Ectomycorrhiza	MRTIGKLRESAEIIWLTKEVSRMLDNSYGITGLILATRMGQPDFLGN
Ga0307517_104389431	3300028786	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIV
Ga0307515_100067117	3300028794	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVNRVLGNSYGITELIVATKIG
Ga0307515_1001300411	3300028794	Ectomycorrhiza	MRIIGNLREITEIIWLTKKVSRVLGNSYGITELIVATKMG
Ga0307515_1003011111	3300028794	Ectomycorrhiza	MRIIGNLCEITGIIIWLTKEVSRMLGNSYGITGLILTAEMG
Ga0307515_100520874	3300028794	Ectomycorrhiza	MRIIGNLCEITRIIIWLTKDISRMLGNSYGITGLILATKMG
Ga0307515_100777676	3300028794	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITELIVATKMS
Ga0307515_100869244	3300028794	Ectomycorrhiza	MRIIGNLREITEIIWLTKKVSRVLGNSYGITGLIMATKMG
Ga0307515_101334772	3300028794	Ectomycorrhiza	MRIIGNLCEITGITIWLTKEVSRMVGNSYGITELILATKIG
Ga0307515_101672822	3300028794	Ectomycorrhiza	MRIIVNLREIAEIIWLTKEVSRVLGNSYGITGLIG
Ga0307515_102535902	3300028794	Ectomycorrhiza	MRIIGNLRKITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307515_102775201	3300028794	Ectomycorrhiza	MRIIGNLKEITEIIWLAKEVSRMLGNSYGITGLTLTIEMG
Ga0307515_102906281	3300028794	Ectomycorrhiza	IIGNLCEITGITIWLTKEVSRMLGNSYGITELILATKIG
Ga0307515_103520601	3300028794	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSQVLGNSYGITGLIVATKMG
Ga0307515_104740842	3300028794	Ectomycorrhiza	MRTIGKIRESAEIIWLTKEVSRVLGNSNGITGLIVATKMG
Ga0307515_105185571	3300028794	Ectomycorrhiza	MRTIGKLRESAEIIWLTKEVSQVLGNSNGITGLIVATKMG
Ga0307515_108050381	3300028794	Ectomycorrhiza	MIIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307511_101267781	3300030521	Ectomycorrhiza	MRIIGNLKEITEIIWLAKEVSWMLGNSYGITGLTLTIEMG
Ga0307511_102444811	3300030521	Ectomycorrhiza	MRIIGNLREITEIIWQTKKVSQVLGNSYGITGLIVATKMG
Ga0307511_102672171	3300030521	Ectomycorrhiza	MRIIGNLCEITGIIIWLAKEGSQMLGNSYGITGLIG
Ga0307511_102793241	3300030521	Ectomycorrhiza	MRIIDNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307511_104084581	3300030521	Ectomycorrhiza	QMRIIGNLREITEIIWLTKEVSRVLGKLYGITGLIVATKMG
Ga0307511_104286661	3300030521	Ectomycorrhiza	MRIIGKLRESAEIIWLTKEVGRVLGNSNGITGLIVATKMG
Ga0307512_100474933	3300030522	Ectomycorrhiza	MRIIGNLCEITGIIIWLKKEVSRMLGNSYGITRLILVAEMG
Ga0307512_101061711	3300030522	Ectomycorrhiza	MRIIDNLXEIIEIIWLTKEVSRMLGDLYGITGLIVATKMG
Ga0307512_101113965	3300030522	Ectomycorrhiza	MRIIGNLCKIIGIVIWLTKEVSRMLGNSYGIIGLILATKMG
Ga0307512_102690131	3300030522	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKTG
Ga0307512_103529691	3300030522	Ectomycorrhiza	MRIIGNLREITKIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307512_104226901	3300030522	Ectomycorrhiza	MRIIRNLREITEIIWLTKEISRVLGNSYGITGLIVATKMS
Ga0307513_100212912	3300031456	Ectomycorrhiza	MRIISNLCEITGIIIWLTKEVSRMLGNSNGIIGLILATKMG
Ga0307513_102136252	3300031456	Ectomycorrhiza	MRIIGNLREITEIIWQTKEVSWVLGNSYGITGLIVATKMG
Ga0307513_102908661	3300031456	Ectomycorrhiza	MRIIGKLREITEIIWLTKEVSRVLGNLYGITGLIVATKMG
Ga0307513_104437931	3300031456	Ectomycorrhiza	MKIIGNLCEITGITIWLTKEVSRMLGNSYGITELILATKIG
Ga0307513_104588051	3300031456	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSQVLGNSYGITGLIVATKMS
Ga0307513_104741561	3300031456	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSWMLGNSYGITGLTLAIEMG
Ga0307513_105192371	3300031456	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIG
Ga0307513_107661531	3300031456	Ectomycorrhiza	RIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMGYPDFLGN
Ga0307509_100370921	3300031507	Ectomycorrhiza	MRIISNLCEITGIIDWLTKEVSRMLGNSYRITELILATKMGYPNFLGN
Ga0307509_101729641	3300031507	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKIG
Ga0307509_102351142	3300031507	Ectomycorrhiza	MRIIGNLREITEINWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307509_104254961	3300031507	Ectomycorrhiza	VEXLLQMRIIGNLREITKIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307509_108220561	3300031507	Ectomycorrhiza	MIIIGILREITKIIWLTKEVSRVLGNSYGITGLIVATK
Ga0307509_109812121	3300031507	Ectomycorrhiza	MRIIGNLSEITEIIWLIKELSRVLGNSYGITGLIG
Ga0307508_100777924	3300031616	Ectomycorrhiza	MRIIGNLCEIIGIIIWLTKKVSRMLGNSYGITILILVTKMD
Ga0307508_101278332	3300031616	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVTTKMG
Ga0307508_102940201	3300031616	Ectomycorrhiza	MRIIGNLKEITKIIWLAKEVSRMLGNSYGITGLTLTIEMG
Ga0307508_102979432	3300031616	Ectomycorrhiza	MRIIGNLKEITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307508_103128731	3300031616	Ectomycorrhiza	MRIIGNLCEIIGIIIWLTKEVSWMLGNSYGITILILATKMG
Ga0307508_106648351	3300031616	Ectomycorrhiza	MRIIGNSREITEIIWLTKKVSRVLGNSYGITGLIMATKMG
Ga0307514_100257492	3300031649	Ectomycorrhiza	MRIIGNLXEITEIIWLTKEVSWMLGNSCGITGLIVAGKMG
Ga0307514_101207901	3300031649	Ectomycorrhiza	MKIIGNLCEITGITIWLTKEVSRMLGNSYGITELILATK
Ga0307514_103306361	3300031649	Ectomycorrhiza	QMRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKTG
Ga0307514_104356761	3300031649	Ectomycorrhiza	LQMRIIGNLREITEIIWLTKEVSRVLGNSYGITRLIVATKMS
Ga0307514_105733291	3300031649	Ectomycorrhiza	GNLCEIIRIIIWLTKEVSWMLGNSYGITILILATKMG
Ga0307516_103925821	3300031730	Ectomycorrhiza	RIIGNLCEITGIIIWLTKEVSRMLGNSYGITGLILTAEMG
Ga0307516_104192361	3300031730	Ectomycorrhiza	NLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307518_100902971	3300031838	Ectomycorrhiza	MRIIGNLREITEIFWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307518_102107822	3300031838	Ectomycorrhiza	MRIIGNLCEITWIIIWLTKKVSRMLGNSYGITGLILATKMG
Ga0307518_103834571	3300031838	Ectomycorrhiza	EXLLQMRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIG
Ga0307518_104703161	3300031838	Ectomycorrhiza	IDNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0325403_100023611	3300032354	Xylem	MRIIGNLREITKIIWLTKEVSQVLGNSYGITELIVATKMGKPDFLGN
Ga0325403_10019925	3300032354	Xylem	MRIIGNLREITKIIWLTKEVSRVMGNSYGITGLIVATKMD
Ga0325403_10054004	3300032354	Xylem	MIIIGNLCEITGIIIWLTKRVSQMLGNSYGITGLILATKMG
Ga0325403_10073166	3300032354	Xylem	MRIIGNLCEITGIIIWLTKEVNRILGNSYGVTALILAAEMG
Ga0325403_10081219	3300032354	Xylem	MRIIGNLREITKIIWLTKEVSQVMGNSCGFTGLIVATKMG
Ga0325403_10099615	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNLYRITGLIVAIKMG
Ga0325403_10110452	3300032354	Xylem	MRIIGNLREIIEIIWLTKEVSRVLGNSYGIIGLIMATKMG
Ga0325403_10119382	3300032354	Xylem	MRIIGNLREITKIIWLTKEVSRVLGNSCGITGLIMATKMG
Ga0325403_10139122	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLSNSYGITGLIVAIKMG
Ga0325403_10152041	3300032354	Xylem	MRIIGKLRESAEIIWLTKEVSRVLGNSNGITGLIVATKMG
Ga0325403_10176711	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLDNSYGITGLIVVTKMG
Ga0325403_10188971	3300032354	Xylem	MRIIGNLCEITGIIIWLTERVSRMLGNLYGITGLILATKIDFLGD
Ga0325403_10236304	3300032354	Xylem	MRIIRNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0325403_10277661	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSCGITGLIMATKMG
Ga0325403_10323511	3300032354	Xylem	MRIIGNLCEITGIIIWLTKEISRMLGNSYGIIGLILATKMG
Ga0325403_10368363	3300032354	Xylem	MKIISNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0325403_10406114	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYEITGLIVATKMG
Ga0325403_10415512	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSWVMGNSCGFTGLIVATKMD
Ga0325403_10448052	3300032354	Xylem	MKIIGNSCEITGIIIWLTKEVSRMLGDSNGITGLILAAEMG
Ga0325403_10604001	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIMATKMG
Ga0325403_11012431	3300032354	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYGITELIMATKMG
Ga0325401_10006502	3300032355	Xylem	MRIIGNLCEITGIIIWLTKEVSRMLGNSYGITRLILVAEMG
Ga0325401_10144006	3300032355	Xylem	MRIIGNSCEITEIIIWLTKEVSRMLGNSNGITGLILAAEMG
Ga0325400_10051601	3300032374	Xylem	MRIIGNLREITEIIWLTKEVSRALGNSYGIIGLIG
Ga0325400_10368362	3300032374	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVVTKMG
Ga0325400_10408074	3300032374	Xylem	MRIIGNLCEITGIIIWLTKEISRMLGNSYGITGLILATKMG
Ga0325405_100024510	3300032389	Xylem	MRIIGNLREITEIIWLTKEVSWMLGNLYEITRLIVATKMG
Ga0325405_10096735	3300032389	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYGITRLIVAIKMG
Ga0325405_10243331	3300032389	Xylem	MRIIGNLCEITGIIIWLTKEVNWMLSNSYGVTALILAAEMG
Ga0325405_10245613	3300032389	Xylem	MRIFGNLREITEIIWLTKEVSWDMGNSYGITGLIVATKMG
Ga0325405_10296151	3300032389	Xylem	MKIISNLREITEIIWLTKEVSRVLGNSYGIIGLIVASKMG
Ga0325405_10720231	3300032389	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYGITELIVATKMGKPDFLGN
Ga0325405_11068911	3300032389	Xylem	MRIIGNLCEITGIIIWLIERVSRMLGNLYGITGLILATKIDFLGD
Ga0325404_100197512	3300032390	Xylem	MRIIGNLREITEIIWLTKEISRVLGNSYGITRLIVETKMG
Ga0325404_10696232	3300032390	Xylem	MRIIGNLIEITKIIWLTKEVSQVLGNSYGITELIVATKMGKPDFLGN
Ga0325410_10106433	3300032735	Xylem	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVAIKMG
Ga0325411_10217936	3300032740	Xylem	MKIIGNLREITKIIWLTKEVSWVMGNSCGFTGLIVATKMG
Ga0325414_10028789	3300032741	Leaf	MRIIGNLREITKIIWLTKKVSRVMGNSYGITGLIVATKMD
Ga0307507_100328214	3300033179	Ectomycorrhiza	MRIIGNLCEITGIIIWLKKKVSRMLGNSYGITRLILVAEMG
Ga0307507_100712631	3300033179	Ectomycorrhiza	MRIIDNLXEIIEIIWLTKEVSRMLGDLYGITRLIVATKMG
Ga0307507_100859852	3300033179	Ectomycorrhiza	MRIIGNLYEITGIIIWLTKRVSRMLGNSYGITGLILATKMG
Ga0307507_101502201	3300033179	Ectomycorrhiza	MRIIGNLREITKIIWLTKEVSWVLGNSYGITGLIVATKMG
Ga0307507_102824131	3300033179	Ectomycorrhiza	MRIIGNLREITEIIWLTKEVSRVLGNSYGITGLTLATKMG
Ga0307510_101842982	3300033180	Ectomycorrhiza	MRIIGNLREITEIIWLKKEVSRVLGNSYGITGLIAATKMG
Ga0307510_103142491	3300033180	Ectomycorrhiza	XLLQMRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKMG
Ga0307510_103920871	3300033180	Ectomycorrhiza	XLLQMRIIGNLREITEIIWLTKEVSRVLGNSYGITGLIVATKTG
Ga0325419_003787_6951_7076	3300034389	Leaf	MRIIGNLCEITGIIIWITKEVSRMLGNSYGITRLILVAEMG
Ga0325419_004796_12008_12133	3300034389	Leaf	MRIIGNLCEITGIIIWLTKKVRRMLGNSYRITGLILATKMG
Ga0325419_009035_3802_3909	3300034389	Leaf	MRIIGNLREITEIIWLTKEVSWRLGNSYGITRLIG
Ga0325423_023794_2721_2846	3300034778	Leaf	MRIIGNLCEITGIIIWLTKEVNWMLGNSYGVTALILAAEMG

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F069517

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign