NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069928

Metagenome / Metatranscriptome Family F069928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069928
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 42 residues
Representative Sequence PRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE
Number of Associated Samples 103
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 27.87 %
% of genes near scaffold ends (potentially truncated) 69.92 %
% of genes from short scaffolds (< 2000 bps) 78.05 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.187 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.390 % of family members)
Environment Ontology (ENVO) Unclassified
(32.520 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.659 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 26.09%    Coil/Unstructured: 73.91%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF02517Rce1-like 13.82
PF05138PaaA_PaaC 11.38
PF01872RibD_C 8.94
PF02634FdhD-NarQ 5.69
PF06243PaaB 2.44
PF00202Aminotran_3 1.63
PF02861Clp_N 1.63
PF16864Dimerisation2 1.63
PF00781DAGK_cat 0.81
PF00486Trans_reg_C 0.81
PF03704BTAD 0.81
PF13458Peripla_BP_6 0.81
PF02781G6PD_C 0.81
PF10604Polyketide_cyc2 0.81
PF01883FeS_assembly_P 0.81
PF04075F420H2_quin_red 0.81
PF06271RDD 0.81
PF13147Obsolete Pfam Family 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 13.82
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 13.82
COG33961,2-phenylacetyl-CoA epoxidase, catalytic subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 11.38
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 8.94
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 8.94
COG1526Formate dehydrogenase assembly factor FdhD, a sulfurtransferaseEnergy production and conversion [C] 5.69
COG34601,2-phenylacetyl-CoA epoxidase, PaaB subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 2.44
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 1.63
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 1.63
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.81
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.81
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.81
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.19 %
UnclassifiedrootN/A0.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001326|A2835W6_1018870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium800Open in IMG/M
3300002558|JGI25385J37094_10002373All Organisms → cellular organisms → Bacteria6269Open in IMG/M
3300002908|JGI25382J43887_10000292All Organisms → cellular organisms → Bacteria15424Open in IMG/M
3300004479|Ga0062595_100844307All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005174|Ga0066680_10100851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1766Open in IMG/M
3300005177|Ga0066690_10470074All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005178|Ga0066688_10000128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria20002Open in IMG/M
3300005186|Ga0066676_10044410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2497Open in IMG/M
3300005436|Ga0070713_102474243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300005444|Ga0070694_101279662All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005445|Ga0070708_100278728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1573Open in IMG/M
3300005454|Ga0066687_10879741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium534Open in IMG/M
3300005545|Ga0070695_100028899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3442Open in IMG/M
3300005553|Ga0066695_10648424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300005554|Ga0066661_10146386All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300005554|Ga0066661_10409770All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005554|Ga0066661_10724435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300005556|Ga0066707_11027300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300005557|Ga0066704_10031669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3232Open in IMG/M
3300005568|Ga0066703_10237518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1107Open in IMG/M
3300005568|Ga0066703_10568741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300005575|Ga0066702_10336688All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300005764|Ga0066903_100856051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1637Open in IMG/M
3300006028|Ga0070717_11008989All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300006034|Ga0066656_10019900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3573Open in IMG/M
3300006050|Ga0075028_100967914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006794|Ga0066658_10426609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium721Open in IMG/M
3300006796|Ga0066665_10009333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5604Open in IMG/M
3300006804|Ga0079221_10455111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium814Open in IMG/M
3300006804|Ga0079221_10912640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium646Open in IMG/M
3300006806|Ga0079220_11481976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium581Open in IMG/M
3300006854|Ga0075425_100567039All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300006903|Ga0075426_11179527All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300006904|Ga0075424_100692295All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300006914|Ga0075436_100100276All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300007255|Ga0099791_10009103All Organisms → cellular organisms → Bacteria4120Open in IMG/M
3300007265|Ga0099794_10791270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300009012|Ga0066710_103450564All Organisms → cellular organisms → Bacteria → Terrabacteria group599Open in IMG/M
3300009088|Ga0099830_10937133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium716Open in IMG/M
3300009089|Ga0099828_10133564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2180Open in IMG/M
3300009090|Ga0099827_10077457All Organisms → cellular organisms → Bacteria2585Open in IMG/M
3300009649|Ga0105855_1245363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300010043|Ga0126380_10472083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → Euzebyaceae → unclassified Euzebyaceae → Euzebyaceae bacterium954Open in IMG/M
3300010159|Ga0099796_10346906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium639Open in IMG/M
3300010329|Ga0134111_10534384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium518Open in IMG/M
3300010333|Ga0134080_10078157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1336Open in IMG/M
3300010366|Ga0126379_12392878All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300010371|Ga0134125_11283514All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300010396|Ga0134126_11771866All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300012189|Ga0137388_11259039All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300012200|Ga0137382_11119288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium562Open in IMG/M
3300012204|Ga0137374_10102059All Organisms → cellular organisms → Bacteria2700Open in IMG/M
3300012205|Ga0137362_10811541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium801Open in IMG/M
3300012207|Ga0137381_10704485All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300012208|Ga0137376_10089450All Organisms → cellular organisms → Bacteria2594Open in IMG/M
3300012208|Ga0137376_10120055All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300012285|Ga0137370_10005210All Organisms → cellular organisms → Bacteria5886Open in IMG/M
3300012349|Ga0137387_10382513All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300012349|Ga0137387_10610607All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300012351|Ga0137386_11262631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300012359|Ga0137385_10053995All Organisms → cellular organisms → Bacteria3587Open in IMG/M
3300012361|Ga0137360_10369872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1203Open in IMG/M
3300012685|Ga0137397_10204507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1469Open in IMG/M
3300012917|Ga0137395_11198302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300012927|Ga0137416_10273338All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300012927|Ga0137416_11054598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium728Open in IMG/M
3300012944|Ga0137410_11114083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium676Open in IMG/M
3300013758|Ga0120147_1027740All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300013763|Ga0120179_1003003All Organisms → cellular organisms → Bacteria5166Open in IMG/M
3300013766|Ga0120181_1012522All Organisms → cellular organisms → Bacteria2365Open in IMG/M
3300014829|Ga0120104_1087248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300015193|Ga0167668_1011347All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300015357|Ga0134072_10331591All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300017654|Ga0134069_1298855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium570Open in IMG/M
3300018027|Ga0184605_10154076All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300018028|Ga0184608_10228828All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300018071|Ga0184618_10105791All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300018431|Ga0066655_10006409All Organisms → cellular organisms → Bacteria4862Open in IMG/M
3300018468|Ga0066662_10126767All Organisms → cellular organisms → Bacteria1877Open in IMG/M
3300018468|Ga0066662_10300995All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300018468|Ga0066662_12674985All Organisms → cellular organisms → Bacteria → Terrabacteria group528Open in IMG/M
3300019885|Ga0193747_1063650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium912Open in IMG/M
3300021180|Ga0210396_10675731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → Euzebyaceae → unclassified Euzebyaceae → Euzebyaceae bacterium893Open in IMG/M
3300025910|Ga0207684_10735196All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300025922|Ga0207646_10167568All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300026309|Ga0209055_1013286All Organisms → cellular organisms → Bacteria4206Open in IMG/M
3300026309|Ga0209055_1149460All Organisms → cellular organisms → Bacteria → Terrabacteria group807Open in IMG/M
3300026309|Ga0209055_1246221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300026309|Ga0209055_1268688All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300026317|Ga0209154_1206182All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300026322|Ga0209687_1119584All Organisms → cellular organisms → Bacteria → Terrabacteria group849Open in IMG/M
3300026326|Ga0209801_1269312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium626Open in IMG/M
3300026333|Ga0209158_1002029All Organisms → cellular organisms → Bacteria12841Open in IMG/M
3300026469|Ga0257169_1083207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300026540|Ga0209376_1305181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium623Open in IMG/M
3300026540|Ga0209376_1410812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
3300026547|Ga0209156_10383927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300026548|Ga0209161_10349008All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300027681|Ga0208991_1072928All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300027681|Ga0208991_1102779All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300027738|Ga0208989_10079828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1119Open in IMG/M
3300027738|Ga0208989_10205202All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300027765|Ga0209073_10088147All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300027787|Ga0209074_10062056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1174Open in IMG/M
3300027857|Ga0209166_10589331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium566Open in IMG/M
3300027862|Ga0209701_10219029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1127Open in IMG/M
3300027862|Ga0209701_10732030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
3300027875|Ga0209283_10019914All Organisms → cellular organisms → Bacteria4098Open in IMG/M
3300027875|Ga0209283_10657612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium659Open in IMG/M
3300027882|Ga0209590_10020978All Organisms → cellular organisms → Bacteria3297Open in IMG/M
3300027882|Ga0209590_10853092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium576Open in IMG/M
3300027910|Ga0209583_10270913All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300027915|Ga0209069_10352079All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300028884|Ga0307308_10445978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300030596|Ga0210278_1008513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1240Open in IMG/M
3300031672|Ga0307373_10553209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium605Open in IMG/M
3300031720|Ga0307469_10010435All Organisms → cellular organisms → Bacteria4515Open in IMG/M
3300031720|Ga0307469_10316198All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300031720|Ga0307469_12446652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300031823|Ga0307478_10350557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1216Open in IMG/M
3300032180|Ga0307471_103544592All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300032261|Ga0306920_102721072All Organisms → cellular organisms → Bacteria675Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil23.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.06%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.06%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.25%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.63%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001326Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A28-35cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013758Permafrost microbial communities from Nunavut, Canada - A24_65cm_12MEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2835W6_101887023300001326PermafrostMSSLPRRDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE*
JGI25385J37094_1000237343300002558Grasslands SoilMPRCPHCREKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD*
JGI25382J43887_1000029213300002908Grasslands SoilMPRCPHCQEKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD*
Ga0062595_10084430723300004479SoilVCPHCKARDPEVISLFGTQAMTLQYRCRRCATVFEAIKYE*
Ga0066680_1010085113300005174SoilREMPRCPHCREKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD*
Ga0066690_1047007423300005177SoilTSPRRGEGAEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKY*
Ga0066688_10000128123300005178SoilMPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD*
Ga0066676_1004441043300005186SoilMPRCPHCRATDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYSG*
Ga0070713_10247424313300005436Corn, Switchgrass And Miscanthus RhizospherePRCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYDA*
Ga0070694_10127966223300005444Corn, Switchgrass And Miscanthus RhizospherePQCPHCREKDADVISLFGTQAMTLQYRCVRCGTVFEAIKYD*
Ga0070708_10027872823300005445Corn, Switchgrass And Miscanthus RhizosphereMPRCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYSD*
Ga0066687_1087974113300005454SoilPPRNTPRPEPRCPHCQARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD*
Ga0070699_10053357913300005518Corn, Switchgrass And Miscanthus RhizospherePPRSDPHCPHCRAQDAEVISLFGTQAMTLQYRCRRCGTLFEAVKYSE*
Ga0070695_10002889923300005545Corn, Switchgrass And Miscanthus RhizosphereMPQCPHCREKDADVISLFGTQAMTLQYRCVRCGTVFEAIKYD*
Ga0066695_1064842413300005553SoilARDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD*
Ga0066661_1014638613300005554SoilEGSREMPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD*
Ga0066661_1040977013300005554SoilCGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD*
Ga0066661_1072443513300005554SoilRRDSPRCTHCGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD*
Ga0066707_1102730013300005556SoilRTEPAPTNPRCPHCHAQEAEVISLFGTQAMTLQYRCRKCGTLFEALKY*
Ga0066704_1003166963300005557SoilRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG*
Ga0066703_1023751813300005568SoilAEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD*
Ga0066703_1056874123300005568SoilSKPRTDPRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG*
Ga0066702_1033668813300005575SoilARDAEVISLFGTQAMTLQYRCRRCRTLFEAIKYD*
Ga0066903_10085605113300005764Tropical Forest SoilRDAEVISLFGTQAMTLQYRCRRCGTLFEAVKYDG*
Ga0070717_1100898913300006028Corn, Switchgrass And Miscanthus RhizosphereCSARDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYEE*
Ga0066656_1001990013300006034SoilPPGGEVPDPRCPHCSARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD*
Ga0075028_10096791413300006050WatershedsRCPHCRERDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYES*
Ga0066658_1042660913300006794SoilRSSPRCPHCGATDAEVLSLFGTQAMTLQYRCRSCATIYEAIKYDPPT*
Ga0066665_1000933313300006796SoilCPHCGKRDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD*
Ga0079221_1045511133300006804Agricultural SoilMPRCPHCKAKDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYAD*
Ga0079221_1091264023300006804Agricultural SoilVPALQAQDAEVISLFGTQAMTLQYRCRKCATVFEGLKY*
Ga0079220_1148197623300006806Agricultural SoilMPRCPHCKAKDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYSD*
Ga0075425_10056703913300006854Populus RhizosphereMPRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG*
Ga0075426_1117952723300006903Populus RhizosphereNPRCPHCKSQDAEVISLFGTQAMTLQYRCRNCGTYFEALKY*
Ga0075424_10069229533300006904Populus RhizospherePHCRSTDAEVISLFGTQAMTLQYRCRKCGTVFEAIKY*
Ga0075436_10010027653300006914Populus RhizosphereMRKLSPIEKKPKCPHCQAQDAEVISLFGTQAMTLQYRCRKCGTVFEGLKY*
Ga0099791_1000910333300007255Vadose Zone SoilMPTCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYDR*
Ga0099794_1079127013300007265Vadose Zone SoilAHDAEVISLFGAQAMTLQYKCRRCGTLFEAIKYD*
Ga0066710_10345056413300009012Grasslands SoilPRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG
Ga0099830_1093713313300009088Vadose Zone SoilHCGMRDAKVISLFGTQAMTLQYRCRKCGTLFEAIKYGE*
Ga0099828_1013356423300009089Vadose Zone SoilMRDAKVISLFGTQAMTLQYRCRKCGTLFEAIKYGE*
Ga0099827_1007745743300009090Vadose Zone SoilLPSCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKY*
Ga0105855_124536323300009649Permafrost SoilPRAEPRCPHCAERDAEVISLFGMQAMTLQYRCRRCGTLFEAIKYEA*
Ga0126380_1047208313300010043Tropical Forest SoilAPRCPRCGAVDGEVISLFGTQAMTLQYRCGSCGDLYEALKYPVEEDQ*
Ga0099796_1034690613300010159Vadose Zone SoilRAEPRCPHCAERDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYSE*
Ga0134111_1053438413300010329Grasslands SoilCSARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD*
Ga0134080_1007815733300010333Grasslands SoilPEGAREMPRCPHCQEKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD*
Ga0126379_1239287823300010366Tropical Forest SoilMPRCPHCGATESEVISLFGTQAMTLQYRCRRCGDFYEALKYEEEEERP*
Ga0134125_1128351423300010371Terrestrial SoilCSAQDAEVISLFGTQAMTLQYRCRRCATLFEAIKYEQA*
Ga0134126_1177186613300010396Terrestrial SoilRCPHCQATGAEVISLFGTQAMTLQYRCRRCGTVFEALKYD*
Ga0137388_1125903923300012189Vadose Zone SoilLRGEGAEPRCPHCSSREAEVISLFGTQAMTLQYKCRKCGTVFEAIKYG*
Ga0137382_1111928813300012200Vadose Zone SoilMPRCPHCREQDSEVISLFGTQAMTLQYRCKRCGTVFE
Ga0137374_1010205953300012204Vadose Zone SoilMPACPHCKALDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYS*
Ga0137362_1081154123300012205Vadose Zone SoilMPRCPHCSATDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYG*
Ga0137381_1070448513300012207Vadose Zone SoilKAPKCPHCHQTDAEVISLFGTQAMTLQYRCRRCGTVFEALKYD*
Ga0137376_1008945053300012208Vadose Zone SoilPHCRENDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYG*
Ga0137376_1012005523300012208Vadose Zone SoilMPRCPHCREQDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD*
Ga0137370_1000521093300012285Vadose Zone SoilMPRCPHCRETDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYD*
Ga0137387_1038251323300012349Vadose Zone SoilMPRCPHCRATDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYPG*
Ga0137387_1061060723300012349Vadose Zone SoilCPHCHAQEAEVISLFGTQAMTLQYRCRKCGTLFEALKY*
Ga0137386_1126263123300012351Vadose Zone SoilCHAQDAEVISLFGTQAMTLQYRCRKCGTLFEALKY*
Ga0137385_1005399543300012359Vadose Zone SoilMPRCPHCQEKDSEVISLFGTQAMTLQYRCMRCGTVFEAIKYD*
Ga0137360_1036987213300012361Vadose Zone SoilCPHCQAQDAEVISLFGTQAMTLQYRCRKCGTYFEGLKY*
Ga0137397_1020450733300012685Vadose Zone SoilMPTCPHCHARDAEVISLFGTQAMTLQYRCRKCGALFEAIKYDR*
Ga0137395_1119830213300012917Vadose Zone SoilHCQAQDAEVISLFGTQAMTLQYRCRKCATYFEALKY*
Ga0137416_1027333833300012927Vadose Zone SoilVTPRADPRCPHCRARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYDR*
Ga0137416_1105459823300012927Vadose Zone SoilGAHDAEVISLFGTQAMTLQYKCRRCGTLFEAIKYD*
Ga0137410_1111408323300012944Vadose Zone SoilVEPACPHCRAREAEVISLFGTQAMTLQYRCRKCGTVFEAIKYDR*
Ga0120147_102774013300013758PermafrostERDAEVISLFGMQAMTLQYRCRRCGTLFEAIKYEE*
Ga0120179_100300383300013763PermafrostRCPHCAERDAEVISLFGMQAMTLQYRCRRCGTLFEAIKYEE*
Ga0120181_101252213300013766PermafrostPHCAKRDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYEE*
Ga0120104_108724823300014829PermafrostPHCSERDAQVISLFGTQAMTLQYRCRRCGTLFEAVKYEE*
Ga0167668_101134723300015193Glacier Forefield SoilLPDPTCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD*
Ga0134072_1033159113300015357Grasslands SoilPRNQPRSEPRCPHCNAKDSELISLFGTQAMTLQYRCRKCGTVFEAIKYA*
Ga0134069_129885513300017654Grasslands SoilTSPPGGEVPDPRCPHCSARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD
Ga0184605_1015407613300018027Groundwater SedimentVPEEEQEEEQPRTSPRCPHCRATDGEVLSLFGTQAMTLQYRCRACGTIYE
Ga0184608_1022882813300018028Groundwater SedimentMPRCPHCRATDAEVISLFGTQAMTLQYRCRKCGTLFEAIK
Ga0184618_1010579133300018071Groundwater SedimentFQRDAQVISLFGTQAMTLQYRCRRCATLFEAVKYEE
Ga0066655_1000640973300018431Grasslands SoilMPRCPHCQEKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD
Ga0066662_1012676713300018468Grasslands SoilRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG
Ga0066662_1030099523300018468Grasslands SoilMPRCPHCREKDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYD
Ga0066662_1267498513300018468Grasslands SoilRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYD
Ga0193747_106365023300019885SoilMPRCPHCKATDAEVISLFGTQAMTLQYRCTQCGTMFEAIKYG
Ga0210396_1067573113300021180SoilAEVISLFGTQAMTLQYRCRRCGDIFEALKYEDGDEKG
Ga0207684_1073519613300025910Corn, Switchgrass And Miscanthus RhizospherePRNQPRSEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKYS
Ga0207646_1016756813300025922Corn, Switchgrass And Miscanthus RhizosphereAVPHCKAQDAEVISLFGTQAMTLQYRCRKCGTLFEALKY
Ga0209055_101328613300026309SoilEPRCPHCNAKDSELISLFGTQAMTLQYRCRKCGTVFEAIKYA
Ga0209055_114946033300026309SoilHCSARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG
Ga0209055_124622123300026309SoilPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD
Ga0209055_126868813300026309SoilCGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD
Ga0209154_120618213300026317SoilSSPRCTHCGERDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD
Ga0209687_111958433300026322SoilDPRCPHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG
Ga0209801_126931223300026326SoilRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKY
Ga0209158_1002029173300026333SoilMPRCPHCREKDSEVISLFGTQAMTLQYRCNRCGTVFEAIKYD
Ga0257169_108320713300026469SoilDPPRSDPRCPHCIARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYG
Ga0209376_130518123300026540SoilNPRCPHCHEQDAEVISLFGTQAMTLQYRCRKCGTLFEALKY
Ga0209376_141081213300026540SoilGTEPAPTNPRCPHCHAQEAEVISLFGTQAMTLQYRCRKCGTLFEALKY
Ga0209156_1038392713300026547SoilRPEAARETPRCPHCRENDSEVISLFGTQAMTLQYRCKRCGTVFEAIKYG
Ga0209161_1034900813300026548SoilHCTARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYG
Ga0208991_107292813300027681Forest SoilARDAEVISLFGTQAMTLQYRCRKCGTLFEGIKYSG
Ga0208991_110277923300027681Forest SoilKPREEPRCPHCRERNAEVISLFGTQAMTLQYRCRKCGTVFEAIKYEA
Ga0208989_1007982833300027738Forest SoilERNAEVISLFGTQAMTLQYRCRKCGTVFEAIKYEA
Ga0208989_1020520223300027738Forest SoilPRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE
Ga0209073_1008814733300027765Agricultural SoilPRSEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTLFEAIKY
Ga0209074_1006205613300027787Agricultural SoilCPHCKAADAEVISLFGTQAMTLQYRCRKCGTVFEAIKY
Ga0209166_1058933123300027857Surface SoilPRCPHCSAMDAEVISLFGTQAMTLQYRCRRCATLFEAIKYD
Ga0209701_1021902913300027862Vadose Zone SoilHCGMRDAKVISLFGTQAMTLQYRCRKCGTLFEAIKYGE
Ga0209701_1073203023300027862Vadose Zone SoilTHCGARDAEVISLFGTQAMTLQYRCRRCGTLFEAIKYD
Ga0209283_1001991413300027875Vadose Zone SoilPHCGARDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYA
Ga0209283_1065761223300027875Vadose Zone SoilCPHCGARDARVISLFGTQAMTLQYRCRKCGTLFEAIKYD
Ga0209590_1002097853300027882Vadose Zone SoilLPSCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKY
Ga0209590_1085309223300027882Vadose Zone SoilMPRCPHCSATDAEVISLFGTQAMTLQYRCKRCGTVFEAIKYG
Ga0209583_1027091313300027910WatershedsPRSDPRCPHCHARDAEVISLFGTQAMTLQYRCRKCGTLFEAIKYE
Ga0209069_1035207913300027915WatershedsRCPHCRERDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYES
Ga0307308_1044597823300028884SoilHCRAQDAEVISLFGTQAMTLQYRCRKCGTLFEAVKYSQ
Ga0210278_100851323300030596SoilVEPRSDPRCPHCTERDAQVISLFGTQAMTLQYRCRRCGTLFEAIKYDE
Ga0307373_1055320923300031672SoilQPRAAPRCPHCAERDAEVISLFGTQAMTLQYRCRKCRTLFEAIKYEE
Ga0307469_1001043533300031720Hardwood Forest SoilMPRCPHCKARDAEVISLFGTQAMTLQYRCRKCGTVFEAIKYR
Ga0307469_1031619833300031720Hardwood Forest SoilCSERDAQVISLFGTQAMTLQYRCRRCGTLFEAIKYEE
Ga0307469_1244665223300031720Hardwood Forest SoilMPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTLFEAIKYS
Ga0307478_1035055713300031823Hardwood Forest SoilQPHSEPRCPHCKAADAEVISLFGTQAMTLQYRCRKCGTLFEAIKYS
Ga0307471_10354459223300032180Hardwood Forest SoilPRCPHCEARDAEVISLFGTQAMTLQYRCRRCGTVFEAIKYD
Ga0306920_10272107213300032261SoilKAGDAEVISLFGTQAITLQYRCRKCGTLFEAIKYE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.