NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070078

Metagenome / Metatranscriptome Family F070078

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070078
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 62 residues
Representative Sequence MSDTPENQGAETEKGFGTGLRAQLQRRREGDEGQAEAQAPTNVELRFELTARPAA
Number of Associated Samples 115
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 96.75 %
% of genes from short scaffolds (< 2000 bps) 93.50 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.577 % of family members)
Environment Ontology (ENVO) Unclassified
(30.894 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.528 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.87%    β-sheet: 0.00%    Coil/Unstructured: 83.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00482T2SSF 95.93
PF13519VWA_2 1.63
PF00486Trans_reg_C 0.81
PF00437T2SSE 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01CW15BAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300001205|C688J13580_1017762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria839Open in IMG/M
3300001536|A1565W1_10187844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300002568|C688J35102_119804419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300003659|JGI25404J52841_10076151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300003911|JGI25405J52794_10057980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria835Open in IMG/M
3300004281|Ga0066397_10151917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300005165|Ga0066869_10097673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300005172|Ga0066683_10609063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300005184|Ga0066671_10128402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1449Open in IMG/M
3300005186|Ga0066676_10922867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300005186|Ga0066676_11183154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300005355|Ga0070671_102114509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300005364|Ga0070673_100952179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria798Open in IMG/M
3300005440|Ga0070705_100025446All Organisms → cellular organisms → Bacteria3209Open in IMG/M
3300005440|Ga0070705_100718681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300005457|Ga0070662_101305211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300005458|Ga0070681_11959031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005468|Ga0070707_100686565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300005544|Ga0070686_101113710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300005546|Ga0070696_100519636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300005553|Ga0066695_10600040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300005553|Ga0066695_10881845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300005554|Ga0066661_10455253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300005564|Ga0070664_101519803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300005566|Ga0066693_10263872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300005598|Ga0066706_11250719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005840|Ga0068870_10817042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300006048|Ga0075363_100685444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300006575|Ga0074053_12010010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300006576|Ga0074047_12035801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300006791|Ga0066653_10697472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300006796|Ga0066665_10718706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300006854|Ga0075425_100675716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1186Open in IMG/M
3300006871|Ga0075434_100622102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1099Open in IMG/M
3300006881|Ga0068865_101361658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300009137|Ga0066709_101794884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300010041|Ga0126312_10544102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300010046|Ga0126384_10890890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300010335|Ga0134063_10402556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300011119|Ga0105246_10162227All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300011994|Ga0120157_1023270All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300011999|Ga0120148_1037085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1025Open in IMG/M
3300012204|Ga0137374_10754572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300012351|Ga0137386_10896763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300012357|Ga0137384_10361781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1201Open in IMG/M
3300012469|Ga0150984_112687817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300012473|Ga0157340_1017002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300012478|Ga0157328_1008400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300012483|Ga0157337_1012326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300012501|Ga0157351_1046225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300012512|Ga0157327_1069430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300012514|Ga0157330_1004548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1138Open in IMG/M
3300012896|Ga0157303_10003516All Organisms → cellular organisms → Bacteria2115Open in IMG/M
3300012897|Ga0157285_10071995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria894Open in IMG/M
3300012955|Ga0164298_10241732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300012977|Ga0134087_10025130All Organisms → cellular organisms → Bacteria2213Open in IMG/M
3300012988|Ga0164306_11433441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300013102|Ga0157371_10168656All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300013102|Ga0157371_10523097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300013297|Ga0157378_11581645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300013306|Ga0163162_11078240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300014325|Ga0163163_12907155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300014497|Ga0182008_10565604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300014968|Ga0157379_10144160All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300015262|Ga0182007_10375830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300017656|Ga0134112_10391208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300018027|Ga0184605_10055796All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300018028|Ga0184608_10531914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300018073|Ga0184624_10118561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1145Open in IMG/M
3300018073|Ga0184624_10353355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300018465|Ga0190269_11045098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300019867|Ga0193704_1000083All Organisms → cellular organisms → Bacteria15023Open in IMG/M
3300019868|Ga0193720_1039360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300019872|Ga0193754_1005175All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300019879|Ga0193723_1031909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1585Open in IMG/M
3300019890|Ga0193728_1373836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300020016|Ga0193696_1169904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300020082|Ga0206353_10428739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300021078|Ga0210381_10268431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300021080|Ga0210382_10214617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300021951|Ga0222624_1128418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300022756|Ga0222622_10330279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1057Open in IMG/M
3300022889|Ga0247785_1014111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300023067|Ga0247743_1048925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300024219|Ga0247665_1044679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300025711|Ga0207696_1168613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300025901|Ga0207688_10148465All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300025908|Ga0207643_10422733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300025911|Ga0207654_10215884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1270Open in IMG/M
3300025960|Ga0207651_10579392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300026023|Ga0207677_12219248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300026116|Ga0207674_10921218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300026295|Ga0209234_1297643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300026787|Ga0207633_103987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300027483|Ga0207637_1002689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300028592|Ga0247822_10980188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300028596|Ga0247821_11036627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300028707|Ga0307291_1028029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1308Open in IMG/M
3300028714|Ga0307309_10045972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300028771|Ga0307320_10169689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300028787|Ga0307323_10013372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2766Open in IMG/M
3300028791|Ga0307290_10053842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1451Open in IMG/M
3300028807|Ga0307305_10216372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300028810|Ga0307294_10014299All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300028810|Ga0307294_10147185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300028814|Ga0307302_10180850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1026Open in IMG/M
3300028819|Ga0307296_10019898All Organisms → cellular organisms → Bacteria3532Open in IMG/M
3300028828|Ga0307312_10176105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1367Open in IMG/M
3300028875|Ga0307289_10063638All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300028875|Ga0307289_10101663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1173Open in IMG/M
3300028875|Ga0307289_10437594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300028878|Ga0307278_10458518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300028884|Ga0307308_10124959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1229Open in IMG/M
3300028885|Ga0307304_10181948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria891Open in IMG/M
3300031548|Ga0307408_100324603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1298Open in IMG/M
3300031908|Ga0310900_10273554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1228Open in IMG/M
3300031913|Ga0310891_10060436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300031940|Ga0310901_10130897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300032000|Ga0310903_10799580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300033551|Ga0247830_11007159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300034818|Ga0373950_0077432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300034819|Ga0373958_0019314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.25%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.25%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.44%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.63%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.63%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.81%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026787Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027483Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_33681302035918004SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAAGGNGDAF
C688J13580_101776213300001205SoilMSETPDNQGAETEKGFGTGLRAQLQRRREGEDGTQPEAQGPTNVELRFELTARPAGGGDLIEMGVGGPDVQALKAELEASKAR
A1565W1_1018784413300001536PermafrostMSDKPDNQAAETEKGFGTGLRAQLQRRREDEGTQQETAQSTNVELRFELTARPAGGDTLE
C688J35102_11980441923300002568SoilMAETPENRSADTEKGFGTGLRAQLQRRQIEEATPAAADGQGQPNVELRFELTARPSGD
JGI25404J52841_1007615123300003659Tabebuia Heterophylla RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAPVDAQGPTNVELRFELTTRPAGGNGETLEVGVGVPDVQA
JGI25405J52794_1005798023300003911Tabebuia Heterophylla RhizosphereMSDKPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELT
Ga0066397_1015191713300004281Tropical Forest SoilMSDKPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGP
Ga0066869_1009767313300005165SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQADSQAPTNVELRFELTARPAAGGNGDTFEVGVG
Ga0066683_1060906323300005172SoilMADKPENQPAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRFELTARPAGGDAETIAISPDLTELKSELEAAQRREA
Ga0066671_1012840213300005184SoilMADKPENQAAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRFELTARPAGGDAETIAISPDLTEL
Ga0066676_1092286723300005186SoilMADKPENQAAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRFELTARPAGGDPETIAISPDLTELKSELEAAQRRE
Ga0066676_1118315413300005186SoilMSTNEHPENRPAETEKGFGTGLRAQLERRREQEDGKPEAAAPTNVELRFELTARPSGDGE
Ga0070671_10211450923300005355Switchgrass RhizosphereMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAAGGNGDAFEVGVGGPDVQALKAELE
Ga0070673_10095217923300005364Switchgrass RhizosphereMSDTPENHGAETEKGFGTGLRAQLQRRREGDEGQGEPQGPTNVELRFELTARPASGETIE
Ga0070705_10002544613300005440Corn, Switchgrass And Miscanthus RhizosphereMADKPENQGAETEKGFGTGLRAQLEQRRRGDEEEGSEQPGPTNVELRFELTAR
Ga0070705_10071868113300005440Corn, Switchgrass And Miscanthus RhizosphereMSDTPEHQGAETEKGFGTGLRAQLQRRREGEGEQAESQGSTNVELRLELTARPGNGETIEAIVGPDVD
Ga0070662_10130521123300005457Corn RhizosphereMAETPEHKSAETEKGFGTGLRAQLQRRQEEAEPAEAQGTPNVELRFELTARPSADAEPVA
Ga0070681_1195903123300005458Corn RhizosphereMAETPEHKPAETEKGFGTGLRAQLQRRQEETEPAEAQGTPNVELRFELTARPSADAEPV
Ga0070707_10068656523300005468Corn, Switchgrass And Miscanthus RhizosphereMADNPENQPAETEKGFGTGLRAQLEQRRKGEGEDPGGEPQGPTNVELRFELTTRPAADPDAVASGPDFTELKAELEAAQRREAALR
Ga0070686_10111371013300005544Switchgrass RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAPVEAQGPTNVELRFELTARPANGGSGETIEGVVGGGPDVQ
Ga0070696_10051963613300005546Corn, Switchgrass And Miscanthus RhizosphereMSETPNNQPAETEKGFGTGLRAQLQRRREDESQPDGGTTNVELRLELTARPA
Ga0066695_1060004013300005553SoilMADKPENQPAETEKGFGTGLRAQLERRRSDEEHAEQPQASTNVELRLELT
Ga0066695_1088184513300005553SoilMSTNEHPENKPAETEKGFGTGLRAQLERRREEEDVQREATASTNVEVRFELTARPSG
Ga0066661_1045525323300005554SoilMSTNEHPENKPAETEKGFGTGLRAQLERRRAEDETPEAAGPTNVELRFELTARPAGDAESLVVGPELTELRSELEA
Ga0070664_10151980313300005564Corn RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAPVEAQGPTNVELRFELTARPANGGNGEVIEGVVGGPDV
Ga0066693_1026387213300005566SoilMADKPENQPAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRFEL
Ga0066706_1125071913300005598SoilMSTNEHPENKPAETEKGFGTGLRAQLERRRAEDETPEAAGPTNVE
Ga0068870_1081704223300005840Miscanthus RhizosphereMSDTPEHQGAETEKGFGTGLRAQLQRRREGEDGTQADGQGPTNVELRFELTARPAGGDTLEAVVGPDVQALKAEL
Ga0075363_10068544413300006048Populus EndosphereMSHTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDAVEGVNPDFEELRVE
Ga0074053_1201001013300006575SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQADSQAPTNVELRFELTARPAAGGNGDTF
Ga0074047_1203580123300006576SoilMSDKPDNQPAETEKGGTGLRAQLQRRREDESQSETEASNVKRLQPKAKAAGDKLAAVADADVQALRAELEAAQ
Ga0066653_1069747213300006791SoilMPDKPENQPAETEKGFGTGLRAQLQRRREEDDDAQEAAPTNVELRFELTARPAGGEGEST
Ga0066665_1071870613300006796SoilMSTNEHPENKPAETEKGFGTGLRAQLERRRAEDETPEAAGPTNVELRFELTARPAGDAESFVVGPELTELRSEL
Ga0075425_10067571613300006854Populus RhizosphereMPDDTPENQKPAETEKGFGTGLRAQLERRREGEEKGAEPQGPTNVELRFELTARPAGGGGDAEVVVNG
Ga0075434_10062210213300006871Populus RhizosphereMPDDTPENQKPAETEKGFGTGLRAQLERRREGEEKGAEPQGPTNVELRFELTARPAGGGGDAEVVVNGPDVTEL
Ga0068865_10136165823300006881Miscanthus RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGSQTETQGSTNVELRFELTARPANGETLEAVVGPDVQALR
Ga0066709_10179488413300009137Grasslands SoilMSDKPENQAAETEKGFGTGLRAQLQRRQGEEAQAEATAPTNVELRFELTARPAGDGETIVGSADSSARPSELHA
Ga0126312_1054410223300010041Serpentine SoilMSDTPEHHGAETEKGFGTGLRAQLQRRRDGEDAIQVDGPGSTNVELRLELTARPAGDTLEAVVGP
Ga0126384_1089089013300010046Tropical Forest SoilMSDTPEHQGAETEKGFGTGLRAQLQRRREGENGEVETQGATNVELRLELTARP
Ga0134063_1040255623300010335Grasslands SoilMADKPENQAAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRFELTARPAGGDAETIAISPDLTELKSELEAAQR
Ga0105246_1016222713300011119Miscanthus RhizosphereMSDTPEHQGAETEKGFGTGLRAQLQRRREGEDGTQADGQGPTNVELRFELTARPAGGDTLEAVVG
Ga0120157_102327013300011994PermafrostMSEQPDNQGAETEKGFGTGLRAQLQRRRDDEDAQPEATGATNVELRFELTARPAGDSL
Ga0120148_103708523300011999PermafrostMSDKPDNQAAETEKGFGTGLRAQLQRRREDEGTQQETAQSTNVELRFELTARPAGGDTLETGVGPGVSALKG
Ga0137374_1075457223300012204Vadose Zone SoilMPDRPENHGAETEKGFGTGLRAQLQRRRDGEEDQAEAPGQTNVELRLELTARPAGDTFEPTVNSDVEALRAELE
Ga0137386_1089676323300012351Vadose Zone SoilMADKPENQAAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRFELTARPAGGDAETIAISPDLTELKSELEAAQRR
Ga0137384_1036178133300012357Vadose Zone SoilMADKPENQAAETEKGFGTGLRAQLERRRGDEDKAVEPQGPTNVELRF
Ga0150984_11268781723300012469Avena Fatua RhizosphereMAETPEHKSAETEKGFGTGLRAQLQRRQEETEPAEAQGTPNVELRFEQIGR
Ga0157340_101700223300012473Arabidopsis RhizosphereMSHTPENQGAETEKGFGTGLRAQLQRRRDGEDPQGDPQAPTN
Ga0157328_100840013300012478Arabidopsis RhizosphereMSDKPDNQPAETEKGFGTGLRAQLQRRREDDTQQGETGSTNVELRFELTARPAGDSLE
Ga0157337_101232613300012483Arabidopsis RhizosphereMSHTPENQGAETEKGFGTGLRAQLQRRRDGEGEQVEQGGPTNVELRFELTARPANGEAIEAVVGPD
Ga0157351_104622513300012501Unplanted SoilMSDKPDNQPAETEKGFGTGLRAQLQRRREDDTQQGETGSTNVELRFELT
Ga0157327_106943023300012512Arabidopsis RhizosphereMSDTPEHQGAETEKEFGTGLRAQLQRRREGEGEQSEMQGSTNVELRLELTARPGN
Ga0157330_100454823300012514SoilMSDKPDNQPAETEKGFGTGLRAQLQRRREDDTQQGETGSTNVELRFELTARPAGDSLEAVVGGPDVQALKAELE
Ga0157303_1000351633300012896SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGEGEQAESQGSTNVELRLELTARPGNGE
Ga0157285_1007199513300012897SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARP
Ga0164298_1024173213300012955SoilMSDTTENQGAETEKGFGTGLRAQLQRRREGEDGTPAEAQGSTNVELRFELTARPSNGETLEAVV
Ga0134087_1002513013300012977Grasslands SoilMSEKPDNQPAETEKGFGTGLRAQLQRRREDESQPDAGTTNVELRFELTARPAGDTLEAVVGPDVQALRAEL
Ga0164306_1143344113300012988SoilMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAAGGNGDA
Ga0157371_1016865613300013102Corn RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTN
Ga0157371_1052309713300013102Corn RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAAGGNG
Ga0157378_1158164523300013297Miscanthus RhizosphereMSETPNNQPAETEKGFGTGLRARLQRRREDESQPDGGTTNVELRLELTARPAGDGLE
Ga0163162_1107824023300013306Switchgrass RhizosphereMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDAVEGVNPEFEE
Ga0163163_1290715513300014325Switchgrass RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGPPVEAQGPTNVELRFELT
Ga0182008_1056560423300014497RhizosphereMADKDENQSAETEKGFGTGLRAQLERRRSDEEGAPEAPGPTNVELRFELTARPAGDHHEVVANSPDFTELRAE
Ga0157379_1014416033300014968Switchgrass RhizosphereMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAAGGNGDAFEVGVGGPDVQALKAEL
Ga0182007_1037583013300015262RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGTPVEAQGPTNVELRFELTARPANGGNGE
Ga0134112_1039120823300017656Grasslands SoilMPDKPENHAAETEKGFGTGLRAQLQRRREGEEGQVEATGSTNVELRLELTARPAGDVAETVL
Ga0184605_1005579613300018027Groundwater SedimentMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGATNVELRFELTARPAGDSLEATVSPDLQE
Ga0184608_1053191413300018028Groundwater SedimentMSETPNNQPAETEKGFGTGLRAQLQRRREDESQPDGGTTNVELRFELTARPAGDGLEAVVNPDVQALKAE
Ga0184624_1011856113300018073Groundwater SedimentMSETPNNQPAETEKGFGTGLRAQLQRRREDESQPDGGTTNVELRLELTARPAGDGLEAVINPDVQALKAE
Ga0184624_1035335513300018073Groundwater SedimentMSDTPENQGAETEKGFGTGLRAQLQRRREGDEGQAEAQAPTNVE
Ga0190269_1104509823300018465SoilMSEKPDNQAAETEKGFGTGLRAQLQRRQEDGSQPEAAGSTNVELRFELTARPAGEASEQVAGPEVDALKA
Ga0193704_1000083173300019867SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDEGQAEAQAPTNVELRFELTARPAAD
Ga0193720_103936013300019868SoilMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGATN
Ga0193754_100517513300019872SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQGAEAQGPTNVELRFE
Ga0193723_103190913300019879SoilMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGATNVELRFELTARPAGDSLEATVSPDLQELKAELEAARAR
Ga0193728_137383623300019890SoilMADKPENQPAETEKGFGTGLRAQLERRRGDEEKAEPGPTNVELRFELT
Ga0193696_116990413300020016SoilMSDTPDNQGAETEKGFGTGLRAQLQRRREGEGTPVEAQGPTNVELRF
Ga0206353_1042873923300020082Corn, Switchgrass And Miscanthus RhizosphereMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQAEGQGPTNVELRFELTARPAAGGN
Ga0210381_1026843113300021078Groundwater SedimentMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGATNVELR
Ga0210382_1021461713300021080Groundwater SedimentMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAQVDGPGPTNVELRFELTARPAGDS
Ga0222624_112841813300021951Groundwater SedimentMSETPENQGAETEKGFGTGLRAQLQRRREGDEGQAEAQAPTNVELRFELTARPAADGLEAVGGSDVSA
Ga0222622_1033027913300022756Groundwater SedimentMSDTPDNQGAETEKGFGTGLRAQLQRRREGEGTPAETQGPTNVELRFELTARPA
Ga0247785_101411113300022889SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDAVEGVNPEFEELRVEL
Ga0247743_104892513300023067SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDAVEGVNPEFEELRVELQA
Ga0247665_104467913300024219SoilMSDTPEHQGAETEKGFGTGLRAQLQRRREGEGEQAESQGSTNVELRLELT
Ga0207696_116861313300025711Switchgrass RhizosphereMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTN
Ga0207688_1014846523300025901Corn, Switchgrass And Miscanthus RhizosphereMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAAGGNGDTSEVGVGGPDVQVLWAEGPMVSE
Ga0207643_1042273323300025908Miscanthus RhizosphereMSDTPDNQGAETEKGFGTGLRAQLQRRREGDDGTQADGQGPTNVELRFELTARPAGGGGLGSPPQ
Ga0207654_1021588413300025911Corn RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAPVEAQGPTNVELRFELTARPANGGSGE
Ga0207651_1057939213300025960Switchgrass RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAPVEAQGPTNVEL
Ga0207677_1221924823300026023Miscanthus RhizosphereMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDAVEGVNPEFEELRVELQAAH
Ga0207674_1092121813300026116Corn RhizosphereMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPT
Ga0209234_129764323300026295Grasslands SoilMPDKPENQPAETEKGFGTGLRAQLQRRREEDDDAQEAAPTNVELRFELTARPAGGEGESTVVSADLAAVKSELGM
Ga0207633_10398713300026787SoilMSDTPEHQGAETEKGFGTGLRAQLQRRREGEGEQAESQGSTNVELRLELTARPGNGETIEAIVGPDVDGLR
Ga0207637_100268923300027483SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFE
Ga0247822_1098018823300028592SoilMSETPENQGAETEKGFGTGLRAQLQRRREGDEGSQAEAQGSTNVELRFELTARPANGETL
Ga0247821_1103662713300028596SoilMSHTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDAVEGVNPEFEELRVELQ
Ga0307291_102802913300028707SoilMSETPNNQPAETEKGFGTGLRAQLQRRREDESQPDGGTTNVELRFELTARPAGDG
Ga0307309_1004597213300028714SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDEGQAEAQAPTNVELRFELTARPAAEGLEAVVGSDVS
Ga0307320_1016968913300028771SoilMSETPNNQPAETEKGFGTGLRAQLQRRREDESQPDGGTTNVELRLELT
Ga0307323_1001337213300028787SoilMADKPENQAAETEKGFGTGLRAQLEQRRQSDEEQAAGEQPTTPTNVELRFELTTRPASDEGV
Ga0307290_1005384233300028791SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDGAQVDGPGPTNVELRFELTARPAGDSLEGIVSPDVEALRA
Ga0307305_1021637223300028807SoilMSETPENQGAETEKGFGTGLRAQLQRRREGDGVQVDGPSPTNVELRFELTARPAGDSLEG
Ga0307294_1001429913300028810SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDEGQAEAQAPTNVELRFELTARPAA
Ga0307294_1014718523300028810SoilMAETPEHKSAETEKGFGTGLRAQLQRRQEEAEPAEAQGTPNVELRFELTARPSAEAEPVAVNADLSALKLE
Ga0307302_1018085023300028814SoilMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGATNVELRFELTARPAGDSLEATVSPDLQ
Ga0307296_1001989813300028819SoilMSTNEHPENKPAETEKGFGTGLRAQLERRREEEDGKPEAAASTNVELRFELTARPSGDGEPFAVGVGAA
Ga0307312_1017610533300028828SoilMADNPQNQPAETEKGFGTGLRAQLERRRSEDGHVPEQQASTNVELRLELRA
Ga0307289_1006363833300028875SoilMPDTPENQGAETEKGFGTGLRAQLQRRREGDGAPAEAQGPTNVELRFELTARPASGETIE
Ga0307289_1010166323300028875SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQADTHGPTNVELRFELTARPAAGGNGDTFEVGVGGPD
Ga0307289_1043759423300028875SoilMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGSTNVELRFELT
Ga0307278_1045851823300028878SoilMADKQENQPAETEKGFGTGLRAQLERRRSEDERAPEQAASTNVELRLELTARPASDNETVIV
Ga0307308_1012495933300028884SoilMADNPQNQPAETEKGFGTGLRAQLERRRSEDGHVPEQQASTNVELRLELR
Ga0307304_1018194813300028885SoilMSDQPDNQGAETEKGFGTGLRAQLQRRRDGEDGQPEAAGATNVELRFELTA
Ga0307408_10032460313300031548RhizosphereMPDTPENQGAETEKGFGTGLRAQLQRRRDGEGEQGEQHGPTNVELRFEL
Ga0310900_1027355413300031908SoilMSDTPEHQGAETEKGFGTGLRAQLQRRREGEGEQAESQGSTNVELRLELTARPGNGE
Ga0310891_1006043613300031913SoilMSDTPENQGAETEKGFGTGLRAQLQRRRDGDDGTQADGQGPTNVELRFELTA
Ga0310901_1013089723300031940SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDA
Ga0310903_1079958023300032000SoilMSQTPENQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELT
Ga0247830_1100715923300033551SoilMSDTPENQGAETEKGFGTGLRAQLQRRREGDDGTQGAEAQGPTNVELRFELTARPAGGEAIEATVGPDVQA
Ga0373950_0077432_465_6893300034818Rhizosphere SoilMSDTPEHQGAETEKGFGTGLRAQLQRRREGEGEQAESQGSTNVELRLELTARPGNGETIEAIVGPDVDGLRDELE
Ga0373958_0019314_1069_12423300034819Rhizosphere SoilMSDTPEHQGAETEKGFGTGLRAQLQRRREGDDGQGEPQGPTNVELRFELTARPASGDA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.