NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070181

Metagenome Family F070181

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070181
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 51 residues
Representative Sequence KLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR
Number of Associated Samples 105
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.32 %
% of genes near scaffold ends (potentially truncated) 87.80 %
% of genes from short scaffolds (< 2000 bps) 92.68 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.187 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(20.325 % of family members)
Environment Ontology (ENVO) Unclassified
(26.829 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.033 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.53%    β-sheet: 0.00%    Coil/Unstructured: 64.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00378ECH_1 27.64
PF13847Methyltransf_31 4.07
PF02776TPP_enzyme_N 4.07
PF04909Amidohydro_2 2.44
PF12847Methyltransf_18 1.63
PF13472Lipase_GDSL_2 1.63
PF09084NMT1 1.63
PF00072Response_reg 0.81
PF01541GIY-YIG 0.81
PF07331TctB 0.81
PF13379NMT1_2 0.81
PF02910Succ_DH_flav_C 0.81
PF060523-HAO 0.81
PF13416SBP_bac_8 0.81
PF13607Succ_CoA_lig 0.81
PF03070TENA_THI-4 0.81
PF13649Methyltransf_25 0.81
PF08123DOT1 0.81
PF12172DUF35_N 0.81
PF07883Cupin_2 0.81
PF13343SBP_bac_6 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.63
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.63

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.19 %
UnclassifiedrootN/A0.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0253904Not Available516Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10021437All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1545Open in IMG/M
3300002075|JGI24738J21930_10079745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300003987|Ga0055471_10196324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300003993|Ga0055468_10032535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1231Open in IMG/M
3300004114|Ga0062593_101068796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium834Open in IMG/M
3300004782|Ga0062382_10333940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300005289|Ga0065704_10269999All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium945Open in IMG/M
3300005294|Ga0065705_10887455All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300005330|Ga0070690_100291303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300005439|Ga0070711_101060446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300005445|Ga0070708_100586640All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300005447|Ga0066689_10936154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300005450|Ga0066682_10801470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300005457|Ga0070662_101292709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300005458|Ga0070681_10903662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300005526|Ga0073909_10013966All Organisms → cellular organisms → Bacteria2499Open in IMG/M
3300005713|Ga0066905_101715158All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium577Open in IMG/M
3300005718|Ga0068866_11000432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300005830|Ga0074473_11233136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium805Open in IMG/M
3300006358|Ga0068871_100819087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium859Open in IMG/M
3300006755|Ga0079222_11319617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300006845|Ga0075421_100407082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1632Open in IMG/M
3300006847|Ga0075431_100026687All Organisms → cellular organisms → Bacteria5924Open in IMG/M
3300006847|Ga0075431_101397203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300006847|Ga0075431_101550740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300006852|Ga0075433_10451626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1133Open in IMG/M
3300006852|Ga0075433_10505615All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300006854|Ga0075425_100435832All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300006854|Ga0075425_102311595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300006880|Ga0075429_100221683All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300006880|Ga0075429_100969593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium743Open in IMG/M
3300006880|Ga0075429_101970071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300006914|Ga0075436_100658758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300006969|Ga0075419_10375233All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300006969|Ga0075419_10906235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300006969|Ga0075419_11456081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300007076|Ga0075435_100545521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1004Open in IMG/M
3300009012|Ga0066710_102998565All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300009094|Ga0111539_11776783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300009147|Ga0114129_10202964All Organisms → cellular organisms → Bacteria2684Open in IMG/M
3300009147|Ga0114129_10856663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1155Open in IMG/M
3300009147|Ga0114129_12203955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300009156|Ga0111538_13870224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300009157|Ga0105092_10288504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium925Open in IMG/M
3300009162|Ga0075423_10687403All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300009553|Ga0105249_12774118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300009811|Ga0105084_1085868All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium584Open in IMG/M
3300009821|Ga0105064_1084678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300010046|Ga0126384_11267986All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium682Open in IMG/M
3300010047|Ga0126382_10126392All Organisms → cellular organisms → Bacteria → Proteobacteria1707Open in IMG/M
3300010366|Ga0126379_12266351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300010399|Ga0134127_13157103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300011427|Ga0137448_1180669All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300011436|Ga0137458_1020953All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300011445|Ga0137427_10064817All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1451Open in IMG/M
3300012038|Ga0137431_1017148All Organisms → cellular organisms → Bacteria → Proteobacteria1977Open in IMG/M
3300012039|Ga0137421_1053403All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1102Open in IMG/M
3300012212|Ga0150985_121916527All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012361|Ga0137360_10379615All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300012929|Ga0137404_10368802All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1260Open in IMG/M
3300012948|Ga0126375_10093937All Organisms → cellular organisms → Bacteria → Proteobacteria1756Open in IMG/M
3300012948|Ga0126375_10151990All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1461Open in IMG/M
3300012961|Ga0164302_11734035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300013297|Ga0157378_11246880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300013306|Ga0163162_11659842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300013306|Ga0163162_13313767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300014267|Ga0075313_1122292All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium654Open in IMG/M
3300014270|Ga0075325_1145794All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium596Open in IMG/M
3300014326|Ga0157380_11540876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium719Open in IMG/M
3300014745|Ga0157377_10789881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300014864|Ga0180068_1079297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300014865|Ga0180078_1030037All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium856Open in IMG/M
3300014865|Ga0180078_1071454All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium598Open in IMG/M
3300014968|Ga0157379_11478683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300014969|Ga0157376_10903125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium901Open in IMG/M
3300015372|Ga0132256_103662049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300015373|Ga0132257_101184509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium967Open in IMG/M
3300015374|Ga0132255_100161095All Organisms → cellular organisms → Bacteria3140Open in IMG/M
3300016294|Ga0182041_10598864All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium968Open in IMG/M
3300016404|Ga0182037_10820917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium803Open in IMG/M
3300018073|Ga0184624_10118545All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium1145Open in IMG/M
3300018073|Ga0184624_10218561All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium852Open in IMG/M
3300018073|Ga0184624_10372032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300018422|Ga0190265_12518394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium613Open in IMG/M
3300018422|Ga0190265_12560974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300018429|Ga0190272_10483329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1045Open in IMG/M
3300018476|Ga0190274_13792602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300019886|Ga0193727_1026578All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300020060|Ga0193717_1053010All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300021081|Ga0210379_10030944All Organisms → cellular organisms → Bacteria → Proteobacteria2071Open in IMG/M
3300022756|Ga0222622_11357471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300023064|Ga0247801_1076405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300025558|Ga0210139_1122489All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300025567|Ga0210076_1032432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1120Open in IMG/M
3300025903|Ga0207680_10561454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium815Open in IMG/M
3300025915|Ga0207693_11456609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300025916|Ga0207663_10875182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300025916|Ga0207663_11709924All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300025931|Ga0207644_10132757All Organisms → cellular organisms → Bacteria → Proteobacteria1908Open in IMG/M
3300025939|Ga0207665_11437816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300025972|Ga0207668_11523095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300026557|Ga0179587_10498367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300027006|Ga0209896_1011507All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium958Open in IMG/M
3300027163|Ga0209878_1017992All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium957Open in IMG/M
3300027462|Ga0210000_1018716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1053Open in IMG/M
3300027548|Ga0209523_1026927All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300027617|Ga0210002_1010422All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300027665|Ga0209983_1025806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1241Open in IMG/M
3300027722|Ga0209819_10107384All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium975Open in IMG/M
3300027787|Ga0209074_10237747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M
3300027880|Ga0209481_10039771All Organisms → cellular organisms → Bacteria2155Open in IMG/M
3300027909|Ga0209382_10242137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2052Open in IMG/M
3300027909|Ga0209382_11935569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
(restricted) 3300031150|Ga0255311_1107463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300031820|Ga0307473_10099276All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300031890|Ga0306925_11368314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300031954|Ga0306926_10125041All Organisms → cellular organisms → Bacteria3174Open in IMG/M
3300032126|Ga0307415_100179859All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300032205|Ga0307472_101418723All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300033004|Ga0335084_11700546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300033433|Ga0326726_10699705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium978Open in IMG/M
3300034147|Ga0364925_0289500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere20.33%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil6.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.06%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand3.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.81%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_025390412228664021SoilWKEYPFKREYPERGMTSAEYEKAEDRWTQLTRGITKR
AF_2010_repII_A001DRAFT_1002143713300000793Forest SoilVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRATTQR*
JGI24738J21930_1007974523300002075Corn RhizosphereYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR*
Ga0055471_1019632413300003987Natural And Restored WetlandsEGQKLMEQFRYGVAWKEYPFKREYPERGMSSAEYEDAEDKWLQLTRSITKK*
Ga0055468_1003253523300003993Natural And Restored WetlandsMERFCYGVAWKDYPFKREYPERGMTSSEYENAEDKWLQLTRSITKRQN*
Ga0062593_10106879613300004114SoilVAWKDYSFKREYPERGMTSAEYEKAEDRWAQLTRAITKR*
Ga0062382_1033394013300004782Wetland SedimentEQFRYGVAWKEYSFKREYPERGMTSVEYEKAEDKWMQATRALTKR*
Ga0065704_1026999913300005289Switchgrass RhizosphereHAALLLTDFVIGADGQKLMEQFRYGVAWKQYPFKREYPERGMTAAQYQDAEEKWSQLLRSITHR*
Ga0065705_1088745513300005294Switchgrass RhizosphereAEGQKIMEQFRYGIAWKEYPFKREYPERGVTTAQYQDAEEKWSQLLRSITQR*
Ga0070690_10029130323300005330Switchgrass RhizosphereFRYGVAWKDYPFKREYPEQGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0070711_10106044613300005439Corn, Switchgrass And Miscanthus RhizosphereGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR*
Ga0070708_10058664023300005445Corn, Switchgrass And Miscanthus RhizosphereLLLTDFVIGAEGQKLMEQFRYGVAWKEYTFKREYPERGMTTSQYQDAEEKWSDLLRSITRR*
Ga0066689_1093615413300005447SoilMEQYRYGVAWKEYPFKRDYPDRGMTSAEYEKAEDKWTQLVRSITRR*
Ga0066682_1080147023300005450SoilMEQFRYGVAWRQYPFKREYPERGMTSAEYEKAEDKWLQLTRSITKRQN*
Ga0070662_10129270923300005457Corn RhizosphereLLFTDFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0070681_1090366223300005458Corn RhizosphereDGQKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQN*
Ga0073909_1001396613300005526Surface SoilKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGGDRF*
Ga0066905_10171515813300005713Tropical Forest SoilMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRATTQR*
Ga0068866_1100043223300005718Miscanthus RhizosphereVIGADGQKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF*
Ga0074473_1123313623300005830Sediment (Intertidal)EYPFKREYPERGMTSVEYEKAEDRWTQLTRAITKR*
Ga0068871_10081908723300006358Miscanthus RhizosphereLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR*
Ga0079222_1131961723300006755Agricultural SoilALLFTDFVIGADGQKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKQQGTNRF*
Ga0075421_10040708213300006845Populus RhizosphereMEQFRYGVAWKEYPFKREYIERGMSSAEYEHAEDKWLQLTRSISKK*
Ga0075431_10002668713300006847Populus RhizosphereMEQFRYGVAWKEYPFKREYPERGMTSAEYENAEDKWLQLTRSISKK*
Ga0075431_10139720313300006847Populus RhizosphereAALLFTDFVIGADGQKLMEQFRYGVAWRDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGDRF*
Ga0075431_10155074013300006847Populus RhizosphereEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0075433_1045162623300006852Populus RhizosphereFTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKRQN*
Ga0075433_1050561513300006852Populus RhizosphereMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0075425_10043583213300006854Populus RhizosphereYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR*
Ga0075425_10231159513300006854Populus RhizosphereLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0075429_10022168333300006880Populus RhizosphereGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR*
Ga0075429_10096959323300006880Populus RhizosphereGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0075429_10197007123300006880Populus RhizosphereDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0075436_10065875813300006914Populus RhizosphereKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0075419_1037523323300006969Populus RhizosphereLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR*
Ga0075419_1090623523300006969Populus RhizosphereVIGADGQKLMEQFRYGVAWRDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGDRF*
Ga0075419_1145608113300006969Populus RhizosphereGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0075435_10054552123300007076Populus RhizosphereQKLMEQFRYGVAWKDYPFKRDYPERGMSSAEYEKAEDRWLQLTRAITKRPN*
Ga0066710_10299856523300009012Grasslands SoilMERVAWKEYPFKREYPERGMTTAQYQDAEEKWTQLLRSTTHR
Ga0111539_1177678323300009094Populus RhizosphereFTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPEQGMTSAEYERAEDRWLQLTRAITKRQN*
Ga0114129_1020296413300009147Populus RhizospherePHATLLLTDFVIGAEGQKLMEQFKYGVAWKEYPFKREYPERGITAAQYQDAEEKWSQLLRSITHR*
Ga0114129_1085666313300009147Populus RhizosphereDFVIGADGQKLMEQFRYGVAWKDYPFKRDYPERGMSSAEYEKAEDKWLQLTRSITKRQGGDRF*
Ga0114129_1220395513300009147Populus RhizosphereKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR*
Ga0111538_1387022413300009156Populus RhizosphereLLTDFVIGAEGQKLMEQFRYGIAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR
Ga0105092_1028850423300009157Freshwater SedimentVAWKEYPFKKEYPERGMSSAEYENAEDKWLQLTRSISKK*
Ga0075423_1068740313300009162Populus RhizosphereKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0105249_1277411823300009553Switchgrass RhizosphereFTDFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0105084_108586813300009811Groundwater SandNAGGSAVIANAPHSHAALLLTDFVIGADGQKLMEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR*
Ga0105064_108467813300009821Groundwater SandMEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR*
Ga0126384_1126798613300010046Tropical Forest SoilFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQSLRAVTQR*
Ga0126382_1012639213300010047Tropical Forest SoilHAALLLTDFVIGAEGQKLMEQFQYGVAWKEYPFKREYPERSMTTAQYQDAEEKWSQLLRSTTQR*
Ga0126379_1226635113300010366Tropical Forest SoilEQYRYGVAWKEYSFKREYPERGMTSSEYEKAEDKWTQLVRSMTRR*
Ga0134127_1315710323300010399Terrestrial SoilFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSADYETAEDKWLQLTRAITKRQN*
Ga0137448_118066923300011427SoilMEQFRYGVAWKEYPFKREYPERGMSSAEYEKAEDRWTQLTRAVTKR*
Ga0137458_102095313300011436SoilTDFVIGAEGQKLMEQFRYGVAWKEYAFKREYPERGMTSAEYEKAEDRWTQATRALTKR*
Ga0137427_1006481713300011445SoilLMEQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR*
Ga0137431_101714833300012038SoilEGQKLMEQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR*
Ga0137421_105340313300012039SoilQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR*
Ga0150985_12191652713300012212Avena Fatua RhizosphereLLTEFILGAEGQKLMEQYRYGVAWKEYPFKREYPERGMTTSEYEKAEDRWTQLVRSITHR
Ga0137360_1037961533300012361Vadose Zone SoilYPFKRDYPERGMTSAEYEKAEDKWTQLVRSITRR*
Ga0137404_1036880223300012929Vadose Zone SoilFVTGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSTTHR*
Ga0126375_1009393713300012948Tropical Forest SoilGVAWKEYPFKREYPERSMTTAQYQDAEEKWSQLLRSTTQR*
Ga0126375_1015199013300012948Tropical Forest SoilTDFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRATTQR*
Ga0164302_1173403513300012961SoilQKLMEQFRYGIAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR*
Ga0157378_1124688023300013297Miscanthus RhizosphereDGQKLMEQFRYGVAWKDYPFKRDYPERGMTSTEYEKNEDKWLQLTRAITKRQGGDRF*
Ga0163162_1165984213300013306Switchgrass RhizosphereEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF*
Ga0163162_1331376713300013306Switchgrass RhizosphereEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGDRF*
Ga0075313_112229213300014267Natural And Restored WetlandsLMEKFKYGVAWKEYPFKREYPERGMTSTQYQDAEDKWIQLLRSIAQRQ*
Ga0075325_114579423300014270Natural And Restored WetlandsFKYGVAWKEYPFKREYPERGMTSTQYQDAEDKWIQLLRSITQRQ*
Ga0157380_1154087613300014326Switchgrass RhizosphereAEGQKLMEQFRYGVAWKDYAFKREYPERGMTSAQYEAAEDKWMNLTRTVTKR*
Ga0157377_1078988113300014745Miscanthus RhizosphereGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0180068_107929723300014864SoilMEQFRYGVAWKEYAFKREYPERGMTSVEYEKAVDRWTQLTRAVTKR*
Ga0180078_103003713300014865SoilKLMEQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR*
Ga0180078_107145413300014865SoilFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR*
Ga0157379_1147868313300014968Switchgrass RhizosphereMEQFRYGVAWKNYPFKREYPEQGMTSAQYEAAEDKWTQLSRALTKR*
Ga0157376_1090312523300014969Miscanthus RhizosphereFTDFVIGADGQKLMEQFRYGVAWKDYPFKREYPEQGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0132256_10366204913300015372Arabidopsis RhizosphereLMEQFRYGVAWKDYPFKREYPEQGMTSAEYERAEDRWLQLTRAITKRQN*
Ga0132257_10118450913300015373Arabidopsis RhizosphereKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN*
Ga0132255_10016109513300015374Arabidopsis RhizosphereRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR*
Ga0182041_1059886413300016294SoilEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN
Ga0182037_1082091723300016404SoilDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN
Ga0184624_1011854513300018073Groundwater SedimentFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR
Ga0184624_1021856123300018073Groundwater SedimentMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGGDRF
Ga0184624_1037203213300018073Groundwater SedimentLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRTITKRQGGDRF
Ga0190265_1251839423300018422SoilFTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSTDYENAEDKWLQLTRSITKK
Ga0190265_1256097423300018422SoilLLFTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSTDYENAEDKWLQLTRSITK
Ga0190272_1048332913300018429SoilLLFTDFVIGADGQKIMEQFRYGVSWKEPPFKREYVELGMSVAEYNKAEKQWGNLLRTLTR
Ga0190274_1379260223300018476SoilLLFTDFVIGAEGQKLMEQFRYGVAWKEYAFKREYPERGMTSAEYEKAEDRWTQLTRAMTK
Ga0193727_102657843300019886SoilLLLTDFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSTTH
Ga0193717_105301013300020060SoilFRYGVAWKDYPFKREYPERGMTSTEYENAEDKWLQLTRSITKRQN
Ga0210379_1003094433300021081Groundwater SedimentGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR
Ga0222622_1135747123300022756Groundwater SedimentGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSTTHR
Ga0247801_107640523300023064SoilMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR
Ga0210139_112248913300025558Natural And Restored WetlandsMDQFRYGVAWKDYPFKREYPERGMTSAQYQDAEDKWSQLLRSTTQR
Ga0210076_103243223300025567Natural And Restored WetlandsMERFCYGVAWKDYPFKREYPERGMTSSEYENAEDKWLQLTRSITKRQN
Ga0207680_1056145413300025903Switchgrass RhizosphereDGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR
Ga0207693_1145660923300025915Corn, Switchgrass And Miscanthus RhizosphereVIGAEGQKLMEQFRYGVAWKEYTFKREYPERGMTTSQYQDAEEKWSDLLRSITRR
Ga0207663_1087518213300025916Corn, Switchgrass And Miscanthus RhizosphereKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR
Ga0207663_1170992423300025916Corn, Switchgrass And Miscanthus RhizosphereDYPFKREYPEQGMTSAEYEKAEDRWLQLTRAITKRQN
Ga0207644_1013275713300025931Switchgrass RhizosphereGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR
Ga0207665_1143781623300025939Corn, Switchgrass And Miscanthus RhizosphereALLFTEFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRSLTKRQN
Ga0207668_1152309523300025972Switchgrass RhizosphereYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF
Ga0179587_1049836713300026557Vadose Zone SoilRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF
Ga0209896_101150723300027006Groundwater SandMEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR
Ga0209878_101799223300027163Groundwater SandALLFTDFVIGADGQKLMEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR
Ga0210000_101871613300027462Arabidopsis Thaliana RhizospherePFKREYPERGMTSSEYENAEDKWLQLTRSITKRQN
Ga0209523_102692743300027548Forest SoilRYGVAWKEYPFKREYPERGMTSSEYEKAEDKWTQLVRSITRR
Ga0210002_101042213300027617Arabidopsis Thaliana RhizosphereFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSADYENAEDKWLQLTRSITKRQN
Ga0209983_102580613300027665Arabidopsis Thaliana RhizosphereDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSADYENAEDKWLQLTRSITKRQN
Ga0209819_1010738423300027722Freshwater SedimentHAALLLTDFVIGADGQKLMEQFRYGVAWKQYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR
Ga0209074_1023774723300027787Agricultural SoilDFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR
Ga0209481_1003977133300027880Populus RhizosphereQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR
Ga0209382_1024213713300027909Populus RhizosphereMEQFRYGVAWKEYPFKREYIERGMSSAEYEHAEDKWLQLTRSISKK
Ga0209382_1193556923300027909Populus RhizosphereTDFVIGADGQKLMEQFRYGVAWRDYPFKRDYPERGMTSAEYEKAEDKWLQLTRSITKRQGGGDRF
(restricted) Ga0255311_110746323300031150Sandy SoilWKDYSFKREYPERGMTSAEYEKAEDRWAQLTRAITKR
Ga0307473_1009927623300031820Hardwood Forest SoilALLLADFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTSQYQDAEEKWSDLLRSITRR
Ga0306925_1136831423300031890SoilTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN
Ga0306926_1012504123300031954SoilMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN
Ga0307415_10017985933300032126RhizosphereEGQKLMEQFRYGVAWKDYPFKREYPERGMTSTEYENAEDKWLQLTRSISKK
Ga0307472_10141872313300032205Hardwood Forest SoilGVAWKKQPFKREYPERGMTSLQYQDAEEKWDQLLQSIVVRR
Ga0335084_1170054623300033004SoilEQFKYGVAWKEYSFKREYPERGMTSLQYQDAEEKWDNLMHSIVVRK
Ga0326726_1069970523300033433Peat SoilGQKLMEHFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSELLRSITHR
Ga0364925_0289500_2_1093300034147SedimentEYSFKREYPERGMTSAEYEKAEDRWMQLTRAITKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.