 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F070396 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DFGRQPIRRGETFALPASLPVRVRAGREPVRVIRCLGPLVE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.016 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.715 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01168 | Ala_racemase_N | 60.98 |
| PF14031 | D-ser_dehydrat | 14.63 |
| PF01152 | Bac_globin | 3.25 |
| PF00324 | AA_permease | 2.44 |
| PF04030 | ALO | 1.63 |
| PF13520 | AA_permease_2 | 1.63 |
| PF00106 | adh_short | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF08940 | DUF1918 | 0.81 |
| PF02826 | 2-Hacid_dh_C | 0.81 |
| PF11774 | Lsr2 | 0.81 |
| PF02653 | BPD_transp_2 | 0.81 |
| PF17042 | NBD_C | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 3.25 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 2.44 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 2.44 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 2.44 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 2.44 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.63 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070683_1006779922 | 3300005329 | Corn Rhizosphere | GSGLVETDSGSQPVRRGQTFALPASLPFRVRAGTEPVRIIRCLGPAA* |
| Ga0066388_1003077863 | 3300005332 | Tropical Forest Soil | GFIEGNFGRRPIRRGETFALPASLPFRVQAGPGPVRVVRCLGPSVT* |
| Ga0070709_103867352 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RQPLRRGQTFAWPASLALRVRAGREPVRIVRCLGPEEAR* |
| Ga0070714_1018550541 | 3300005435 | Agricultural Soil | RQALRRGQTFAWPASLALRVRAGREPVRIVRCMGPEEAG* |
| Ga0070710_100539042 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RQPVRKGQTFAWPASLSLRLRAGREPVRVVRCLGPLLGPAV* |
| Ga0070711_1018754902 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | WAEGEFGRQPLRRGQTFAWPASLALRVRAGREPVRIVRCLGPEEAR* |
| Ga0070708_1001715441 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SIEGNFGRKPIRRGETLALPASLPFRVQAGPEPVRVIRCLGPNVE* |
| Ga0070706_1015046262 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGSGLLEGNFGSQPIRRGETYALPASLPLRVRAEAEEVGVVRCLGPAAG* |
| Ga0070679_1003321842 | 3300005530 | Corn Rhizosphere | SGSGLVETDSGSQPVRRGQTFALPASLPFRVRAGTEPVRIIRCLGPAA* |
| Ga0066699_103106901 | 3300005561 | Soil | DFGQQPVRKGQTFAWPASLSLRVRAGREPVRIVRCLGPREA* |
| Ga0068855_1018807992 | 3300005563 | Corn Rhizosphere | RKGQTFAWPASLSLRLCAGRAPVRIVRCLGPREA* |
| Ga0070763_100881561 | 3300005610 | Soil | GRQPVRKGETFALPASLPVRVRAGREPVRVIRCLGPAVD* |
| Ga0070763_104408802 | 3300005610 | Soil | QPIRRGETYALPASLSFRVRSGREPLRVVRCFGPAAA* |
| Ga0070766_101092471 | 3300005921 | Soil | QPIRRGETYALPASLPFRIRAAAAGAEPLRVIRCLGPAVR* |
| Ga0070717_105790331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EGDFGRQPIRRGQTFALPASLPVRIRAGREPVRVIRCLGPAGS* |
| Ga0070717_110618242 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QPIRRGETYALPASLPFRVRAGREPLRVVRCFGPAAE* |
| Ga0066696_111047591 | 3300006032 | Soil | GDFGRQPIRKGQAFAWPASLALRVRAGREPVRIVRCLGPREA* |
| Ga0070712_1005902111 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RGQTLALPASLPVRVRAGPEPVRVIRCLGPAEPARHDQ* |
| Ga0097621_1009158612 | 3300006237 | Miscanthus Rhizosphere | FGNQPIRRGETFALPASLHVRVRAGTEPVKVIRCLGPAAE* |
| Ga0097621_1010402621 | 3300006237 | Miscanthus Rhizosphere | LRRGQTFAWPASLALRVRAGREPVRIVRCRGPEEAR* |
| Ga0066665_111741611 | 3300006796 | Soil | QQPVRKGQTFAWPASLSLRVRAGREPVRIVRCLGPREA* |
| Ga0079221_100863913 | 3300006804 | Agricultural Soil | RRGQTFALPASLPIRVRAGSEDVRVIRCLGPTPA* |
| Ga0073928_102332121 | 3300006893 | Iron-Sulfur Acid Spring | FVEGDFGSLPVRRGDTFALPASLPVRVRAQHEPVRVVRCLGPAAS* |
| Ga0073928_102824752 | 3300006893 | Iron-Sulfur Acid Spring | GSQPIRRGETYAVPASLPFLVRAGSEPIRVVRCFGPAAERAPS* |
| Ga0099830_117689082 | 3300009088 | Vadose Zone Soil | RQPIEKGQSFAWPACLALRLRAGREPLRVVRCLGET* |
| Ga0066709_1022651761 | 3300009137 | Grasslands Soil | ASGSGSIEGEFGSQPIRRGETFALPASLHFRVRAGTEPVRVIRCLGPAAE* |
| Ga0126374_113320502 | 3300009792 | Tropical Forest Soil | FGRQPIRRGETFALPASLHFRVRAETEPVKVIRCLGPAAE* |
| Ga0126373_105778831 | 3300010048 | Tropical Forest Soil | SGTGWIESDFGSQPIRQGETYALPASLPFRIRAGTEPVRVVRCLGPGAE* |
| Ga0126373_128536772 | 3300010048 | Tropical Forest Soil | VVAGSGSVDGDFGRQPVRHGQTFAVPASLPVRVRAGREPVRVIRCLGPEPE* |
| Ga0123356_140988262 | 3300010049 | Termite Gut | SEVVSRGETYALPASMPFRVRAGAESLRIIRCLGPTTEP* |
| Ga0126370_103079761 | 3300010358 | Tropical Forest Soil | SGAGSLEGDFGTQPLSRGETYALPASVPFRVRAGREPLRVIRCLGPTTEH* |
| Ga0126372_115564142 | 3300010360 | Tropical Forest Soil | GRRPIRRGETFALPASLPFRVQAGPGPVRVVRCLGPSVT* |
| Ga0126378_116433902 | 3300010361 | Tropical Forest Soil | SIDGDFGSEPVRRGQTFALPAGLPIRVRAGTEAVRVIRCLGPAPA* |
| Ga0134066_103972622 | 3300010364 | Grasslands Soil | IRKGQAFAWPASLALRVRAGREPVRIVRCLGPREA* |
| Ga0126379_111762332 | 3300010366 | Tropical Forest Soil | SGSIDGGFGSQPVSQGETYALPASVPFRVRAGRDPLRVIRCLGPTTEP* |
| Ga0126381_1001830733 | 3300010376 | Tropical Forest Soil | IEGDFGVQPIRRGQTFALPASFGFRVRAGSAGPVRVIRCLGPPSSD* |
| Ga0126381_1003663871 | 3300010376 | Tropical Forest Soil | FGSQPIRRGETFALPANLPFRVRSAAELLRVVRCLGPANY* |
| Ga0126381_1040469481 | 3300010376 | Tropical Forest Soil | IEGNFGRRPIRRGETLALPASLPFRVQAGPEPVRVVRCLGPNVE* |
| Ga0126383_113386961 | 3300010398 | Tropical Forest Soil | GRVPVRSGQTFALPASLPIRVRAGSEAVRVIRCLGPAPP* |
| Ga0126383_114860301 | 3300010398 | Tropical Forest Soil | QPIRRGETFALPASLQFRVRAGSEPVRVIRCLGPAAE* |
| Ga0134123_102049671 | 3300010403 | Terrestrial Soil | QPVRKGQTFAWPASLSLRLCAGRAPVRVVRCLGPAV* |
| Ga0126356_109836701 | 3300010877 | Boreal Forest Soil | TGSIDGDFGSQPVRRGQTFALPASLPTRVRAGREAVRVIRCLGPAVA* |
| Ga0137370_107865361 | 3300012285 | Vadose Zone Soil | GDGWAEGDFGQQPVRKGQTFAWPASLSLRVRAGREPVRVVRCLGSTV* |
| Ga0137361_118656292 | 3300012362 | Vadose Zone Soil | SIDGDFGSQPVRRGQTFALPASLPTRVRAGREAVRVIRCLGPVVA* |
| Ga0137410_119139122 | 3300012944 | Vadose Zone Soil | GRLPVRRGETFALPASLAFRLRAGQEPVHVIRCLGPAVDEDA* |
| Ga0164303_101084091 | 3300012957 | Soil | AGSIEGEFGRQPIRRGETFALPASLRFRVRAGAEPVRVIRCLGPAAE* |
| Ga0157369_114622872 | 3300013105 | Corn Rhizosphere | GAGFIDGDFGAQPVARGQTLALPASLPVRVRAGPEPVRVIRCLGPAEPARHDQ* |
| Ga0132257_1028683512 | 3300015373 | Arabidopsis Rhizosphere | AGFIEGNFGRRPIRRGETFALPASLHFRVQAGPEPVRVVRCLGPIVE* |
| Ga0182041_115975942 | 3300016294 | Soil | QPVRRGQTFALPASLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0182035_109228522 | 3300016341 | Soil | DGDFGRQPIRRGQTFAMPASLPTRVRAGREPVRVIRCFGPSPL |
| Ga0187809_100745272 | 3300017937 | Freshwater Sediment | DFGRQPIRKGQAFAWPASLALRVRAGREPVRIVRCLGPREA |
| Ga0187785_104217931 | 3300017947 | Tropical Peatland | GRMPIRRGETLALPASLPFRVRAGRERVNVVRCLGPGAE |
| Ga0187782_114379662 | 3300017975 | Tropical Peatland | VVSGDGYLEGDFGRQPIRRGETFALPASLPVRARAGREPVRVVRCLGPALE |
| Ga0181520_111351022 | 3300017988 | Bog | LPISRGDTFALPASLAFAAVAAEEPVRIVRCLGPSTE |
| Ga0187765_109029732 | 3300018060 | Tropical Peatland | GSQRVRQGETYALPASLPFRVRAGREPLRVIRCLGPTTEP |
| Ga0187772_101012833 | 3300018085 | Tropical Peatland | DGSVEGDFGRWPVRRGDTFALPASLTVRVRAGREPVRVVRCLGPTLE |
| Ga0187774_103627292 | 3300018089 | Tropical Peatland | VASGAGSIEGEFGSQPIRRGETFALPASLQFRVRAGSEPVRVIRCLGPAAE |
| Ga0187774_112876892 | 3300018089 | Tropical Peatland | FGRQPIRRGETFALPASLHFRVRAGTEPVRVIRCLGPAAE |
| Ga0210399_111650092 | 3300020581 | Soil | DGDFGSQPVRQGQTFALPASLPIRVRAGPEAVRVIRCLGPSRNDQHRMSSTA |
| Ga0210405_103719112 | 3300021171 | Soil | SQPIRRGETYALPASLPFRVRAGREPLRVVRCFGPAAE |
| Ga0210396_112884721 | 3300021180 | Soil | PIRRGETYALPASLSFRVRSGREPLRVVRCFGPAAA |
| Ga0210388_110487511 | 3300021181 | Soil | EGDFGTQPIRRGETYALPASLPFRIRAAAAGAEPLRVIRCLGPAVR |
| Ga0213882_102864782 | 3300021362 | Exposed Rock | DCGGQPIGKGQSFAWPASLALRVRAGREPVRIVRCMGPEEAR |
| Ga0210386_106654921 | 3300021406 | Soil | GTQPIRRGETYALPASLPFRIRAAAAGAEPLRVIRCLGPAVR |
| Ga0210390_1000421913 | 3300021474 | Soil | EGDFGSQPIGRGETYALPASLPFRVRAGREPLRVVRCFGPADRAPA |
| Ga0210390_102365181 | 3300021474 | Soil | RLPLRPGQSFAWPASLALRVRAGREPLRVVRCLGPS |
| Ga0210398_105064801 | 3300021477 | Soil | RGETYALPASLPFRIRAAAAGAEPLRVIRCLGPAVR |
| Ga0210398_105763071 | 3300021477 | Soil | EGEFGRVPIRRGETFALPASLPFRVRAEREPVRVVRCLGPSTE |
| Ga0210402_103679442 | 3300021478 | Soil | FGRQPIRKGQTFAWPASLALRVRAGQEPVRIVRCLGPQEA |
| Ga0126371_128101841 | 3300021560 | Tropical Forest Soil | PIRPGETFALPASLPVRVRAGREPVRVVRCLGPVVT |
| Ga0126371_128248392 | 3300021560 | Tropical Forest Soil | GSQPIRRGETFALPASLQFRVRAGSEPVRVIRCLGPAAE |
| Ga0179589_106117501 | 3300024288 | Vadose Zone Soil | EFGSQPIRRGETFALPASLHLRVRAGTEPVKVIRCLGPAAE |
| Ga0207693_104837332 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SQPICRGETFALPASLHFRVRAGTEPVRVIRCLGPAAE |
| Ga0207663_109730212 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DGWAEGDFGRQPIRKGQAFAWPASLALRVRAGREPVRIVRCLGPREA |
| Ga0207687_112597272 | 3300025927 | Miscanthus Rhizosphere | DFGRQPIRRGETFALPASLHVRVRAGTEPVKVIRCLGPAAE |
| Ga0207700_100494854 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AEGDFGRQPIRKGQAFAWPASLALRVRAGREPVRIVRCLGPQEA |
| Ga0207704_103350081 | 3300025938 | Miscanthus Rhizosphere | GDFGRQPLRKGQTFAWPASLSLRLCAGRAPLRVVRCLGPATR |
| Ga0207676_105590211 | 3300026095 | Switchgrass Rhizosphere | VSGAGFIDGDFGAQPVARGQTLALPASLPVRVRAGPEPVRVIRCLGPAEPARHDQ |
| Ga0209474_105973862 | 3300026550 | Soil | GDFGRQPIRKGQAFAWPASLALRVRAGREPVRIVRCLGPREA |
| Ga0209008_10704342 | 3300027545 | Forest Soil | DGDFGRQPVRRGQTFAVPASLPTRVRAGPDPVRVIRCLGPVAA |
| Ga0209074_104416332 | 3300027787 | Agricultural Soil | IEGNFGRRPIRRGETFALPASLPFRVWAGPEPVRVVRCLGPSVT |
| Ga0209656_100231731 | 3300027812 | Bog Forest Soil | AVVVCGAGSIDGDFGSQPVRRGQTFAVPASLPTRVRAGPEAVRVIRCLGPTLT |
| Ga0209180_104065862 | 3300027846 | Vadose Zone Soil | RIRAGETFALPASLPFRVRAGREPVRVVRCFGPGTP |
| Ga0209590_108622762 | 3300027882 | Vadose Zone Soil | ASGAGFVEGAFGSRPIRRGETFALPASLSLRVRAGREPVRVVRCLGPSVE |
| Ga0209006_101361313 | 3300027908 | Forest Soil | GREPIRRGQTFALPASLPVAIRAGREPVRVIRCLGPAVP |
| Ga0209006_114844372 | 3300027908 | Forest Soil | SIHGNFGDVAVRRGETFALPAHLPIRVAAGREPLRIVRCFGPTAN |
| Ga0307323_100127881 | 3300028787 | Soil | FGSRPVRRGETFALPASLHFRVRAGGEPVRIIRCLGPAAE |
| Ga0307312_102779151 | 3300028828 | Soil | PVRRGETFALPASLHFRVRAGGEPVRIIRCLGPAAE |
| Ga0307501_100613531 | 3300031152 | Soil | GDGWAEGDFGRQPVRKGQTFAWPASLSLRLCAGRAPVRVVRCLGPAV |
| Ga0307506_103704381 | 3300031366 | Soil | RQPLRKGQTFAWPASLSLRLCAGQEPLRVVRCLGPATR |
| Ga0318573_107967291 | 3300031564 | Soil | IEGEFGSQPIRRGETFALPASLHFRVRAGTEPVRVIRCLGPAAE |
| Ga0318555_104183601 | 3300031640 | Soil | SGTGSIDGDFGRQPVRRGQTFALPASLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0318561_104647091 | 3300031679 | Soil | GFIEGNFGRVPIRRGETLALPASLPVRVHAGPEPVHVVRCLGPGVEGL |
| Ga0318572_102191892 | 3300031681 | Soil | GSEQVRRSETFALPASLPVRVRAGREPLRIIRCLGPAVP |
| Ga0318493_103052832 | 3300031723 | Soil | LEGDFGRRPIRRGETFALPASLPVRVRAGQEPVRVVRCLGPVVE |
| Ga0318500_101599911 | 3300031724 | Soil | RQPVRRGETFALPASLPVRVRAGREPVRVIRCLGPKVP |
| Ga0318492_105225132 | 3300031748 | Soil | DGDFGRQPVRRGQTFALPASLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0318494_103674731 | 3300031751 | Soil | RVPIRRGETLALPASLPVRVHAGPEPVHVVRCLGPGVEGL |
| Ga0318554_100664973 | 3300031765 | Soil | EGDFGRRPIRRGETFALPASLPVRVRAGQEPVRVVRCLGPVVE |
| Ga0318554_108749981 | 3300031765 | Soil | FGRQPVRRGETFALPASLPVRVRAGREPVRVIRCLGPKVP |
| Ga0318509_103814701 | 3300031768 | Soil | GGFGRVPIRRGQTFALPASLPFRVRAERDEPVRVIRCLGPGAG |
| Ga0318521_105824811 | 3300031770 | Soil | VAGTGSIDGDFGSQPVRRGQTFALPASLPIRVRAGPEAVRVSRCLGPTPE |
| Ga0318546_106382951 | 3300031771 | Soil | SIDGDFGRQPVRRGQTFALPASLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0318529_100714253 | 3300031792 | Soil | SQPVRRGQTFALPASLPIRVRAGREAVRVIRCLGPAVA |
| Ga0318564_101922412 | 3300031831 | Soil | QVRRGETFALPASLPGRVRAGREPLRIIRCLGPAVP |
| Ga0306919_112378861 | 3300031879 | Soil | VSGAGSIDGDFGSEPVRRGQTFALPASLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0318544_102566541 | 3300031880 | Soil | IDGDFGSQPVRGGQTFALPASLPIRVRAGREAVRVIRCLGPAVA |
| Ga0310916_113205951 | 3300031942 | Soil | VRRGETFALPASLPVRVRAGREPVRVIRCLGPKVP |
| Ga0310909_104106662 | 3300031947 | Soil | SRGETYALPACVPFRVRAAREPLRIIRCLGPTTEL |
| Ga0318531_105781471 | 3300031981 | Soil | IDGDFGREPVRRGQTFALPAGLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0318562_108215421 | 3300032008 | Soil | AGWVEGGFGRVPIRRGQTFALPASLPFRVRAERDEPVRVIRCLGPGAG |
| Ga0318563_100672821 | 3300032009 | Soil | EGDFGRQPIRRGETFALPASLPVRVRAGREPVRVIRCLGPLVE |
| Ga0318504_101121392 | 3300032063 | Soil | VRRGQTFAVPASLPIRVRAGREAVRVIRCLGPAVA |
| Ga0318524_101917141 | 3300032067 | Soil | AFEGDFGRRSIRRGETFALPASLTFRVRAGREPVRVVRCFGPSLE |
| Ga0318553_100420803 | 3300032068 | Soil | DFGRQPIRRGETFALPASLPVRVRAGREPVRVIRCLGPLVE |
| Ga0318553_101344051 | 3300032068 | Soil | AGWVQGGFGRVPIRRGQTFALPASLPFRVRAERDEPVRVIRCLGPGAG |
| Ga0318553_105560491 | 3300032068 | Soil | DFGRQPVRRGQTFALPASLPIRVRAGTEAVRVIRCLGPAVA |
| Ga0306924_105138861 | 3300032076 | Soil | IDGDFGNQPVSRGETYALPACVPFRVRAAREPLRIIRCLGPTTEL |
| Ga0318518_105660771 | 3300032090 | Soil | VEGGFGRVPIRRGQTFALPASLPFRVRAERDEPVRVIRCLGPGAG |
| Ga0335085_113029142 | 3300032770 | Soil | MTSDFGRQPIRKGQTFAWPASLALRVRAGQEPVRIVRCLGPQEA |
| Ga0335082_100682504 | 3300032782 | Soil | VRRGQTFALPASLPIRVRAGREAVRVIRCLGPAVA |
| Ga0318519_106145152 | 3300033290 | Soil | VAGAGFIEGNFGRVPIRRGETLALPASLPVRVHAGPEPVHVVRCLGPGVEGL |
| Ga0326726_120051231 | 3300033433 | Peat Soil | VEGDFGRAPIRRGETFALPASLPVRVRAGREPVRVVRCLGPDPA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |