Metagenome / Metatranscriptome Family F070782

Basic Information
Family ID	F070782
Family Type	Metagenome / Metatranscriptome
Number of Sequences	122
Average Sequence Length	44 residues
Representative Sequence	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Number of Associated Samples	44
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.18 %
% of genes from short scaffolds (< 2000 bps)	54.92 %
Associated GOLD sequencing projects	29
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Bacteria (86.885 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (96.721 % of family members)
Environment Ontology (ENVO)	Unclassified (98.361 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (97.541 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 7.50% β-sheet: 30.00% Coil/Unstructured: 62.50%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF00528	BPD_transp_1	4.10
PF13635	DUF4143	3.28
PF13807	GNVR	3.28
PF13610	DDE_Tnp_IS240	2.46
PF05228	CHASE4	2.46
PF11867	DUF3387	2.46
PF01370	Epimerase	2.46
PF00496	SBP_bac_5	1.64
PF13020	NOV_C	1.64
PF09484	Cas_TM1802	1.64
PF01293	PEPCK_ATP	1.64
PF14239	RRXRR	1.64
PF01527	HTH_Tnp_1	1.64
PF03977	OAD_beta	0.82
PF01555	N6_N4_Mtase	0.82
PF17164	DUF5122	0.82
PF13458	Peripla_BP_6	0.82
PF04851	ResIII	0.82
PF13379	NMT1_2	0.82
PF04055	Radical_SAM	0.82
PF13276	HTH_21	0.82
PF12323	HTH_OrfB_IS605	0.82
PF01041	DegT_DnrJ_EryC1	0.82
PF02348	CTP_transf_3	0.82
PF02397	Bac_transf	0.82
PF00535	Glycos_transf_2	0.82
PF00908	dTDP_sugar_isom	0.82
PF00271	Helicase_C	0.82
PF01385	OrfB_IS605	0.82
PF09704	Cas_Cas5d	0.82
PF04932	Wzy_C	0.82
PF03235	DUF262	0.82
PF00288	GHMP_kinases_N	0.82
PF09827	CRISPR_Cas2	0.82
PF00722	Glyco_hydro_16	0.82
PF16933	PelG	0.82
PF02803	Thiolase_C	0.82
PF00239	Resolvase	0.82
PF11842	DUF3362	0.82
PF04991	LicD	0.82
PF00075	RNase_H	0.82
PF00701	DHDPS	0.82
PF05107	Cas_Cas7	0.82
PF13450	NAD_binding_8	0.82
PF12161	HsdM_N	0.82
PF00905	Transpeptidase	0.82
PF12950	TaqI_C	0.82
PF00483	NTP_transferase	0.82
PF13193	AMP-binding_C	0.82
PF00326	Peptidase_S9	0.82

COG ID	Name	Functional Category	% Frequency in 122 Family Scaffolds
COG3322	Extracellular (periplasmic) sensor domain CHASE (specificity unknown)	Signal transduction mechanisms [T]	2.46
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	1.64
COG1866	Phosphoenolpyruvate carboxykinase, ATP-dependent	Energy production and conversion [C]	1.64
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	0.82
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.82
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.82
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.82
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.82
COG0675	Transposase	Mobilome: prophages, transposons [X]	0.82
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.82
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.82
COG1083	CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family	Cell wall/membrane/envelope biogenesis [M]	0.82
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.82
COG1212	CMP-2-keto-3-deoxyoctulosonic acid synthetase	Cell wall/membrane/envelope biogenesis [M]	0.82
COG1479	DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains	Defense mechanisms [V]	0.82
COG1861	Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family	Cell wall/membrane/envelope biogenesis [M]	0.82
COG1883	Na+-transporting oxaloacetate/methylmalonyl-CoA decarboxylase, beta subunit	Energy production and conversion [C]	0.82
COG1898	dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme	Cell wall/membrane/envelope biogenesis [M]	0.82
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.82
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	0.82
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.82
COG2273	Beta-glucanase, GH16 family	Carbohydrate transport and metabolism [G]	0.82
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.82
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.82
COG3307	O-antigen ligase	Cell wall/membrane/envelope biogenesis [M]	0.82
COG3475	Phosphorylcholine metabolism protein LicD	Lipid transport and metabolism [I]	0.82
COG3649	CRISPR-Cas system type I effector complex subunit Cas7, RAMP superfamily	Defense mechanisms [V]	0.82

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.16 %
Unclassified	root	N/A	9.84 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.70 %
Unclassified	root	N/A	9.84 %
Viruses	superkingdom	All Organisms → Viruses	2.46 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.89 %
Unclassified	root	N/A	9.84 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogae	phylum	All Organisms → cellular organisms → Bacteria → Thermotogae	64.75 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	11.48 %
Unclassified	root	N/A	9.84 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.82 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.82 %
Aquificae	phylum	All Organisms → cellular organisms → Bacteria → Aquificae	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogae	class	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	64.75 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	11.48 %
Unclassified	root	N/A	9.84 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %
Aquificae	class	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae	0.82 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogales	order	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	47.54 %
Unclassified	root	N/A	9.84 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	5.74 %
Petrotogales	order	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales	4.92 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	4.10 %
Mesoaciditogales	order	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Tissierellia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia	0.82 %
Aquificales	order	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales	0.82 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Fervidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae	21.31 %
Thermotogaceae	family	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae	13.11 %
Unclassified	root	N/A	9.84 %
Petrotogaceae	family	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae	4.92 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	4.10 %
Mesoaciditogaceae	family	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Thermoanaerobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales	1.64 %
unclassified Tissierellia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia	0.82 %
Aquificaceae	family	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae	0.82 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Fervidobacterium	genus	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	19.67 %
unclassified Thermotogaceae	no rank	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae	12.30 %
Unclassified	root	N/A	9.84 %
Paenibacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	4.10 %
Petrotoga	genus	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga	4.10 %
Mesoaciditoga	genus	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Pseudothermotoga	genus	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Marinitoga	genus	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga	0.82 %
unclassified Aquificaceae	no rank	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae	0.82 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.82 %
Thermoanaerobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella	4.10 %
unclassified Fervidobacterium	no rank	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
unclassified Petrotoga	no rank	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
unclassified Thermoanaerobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae	0.82 %
Fervidobacterium pennivorans	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Gastropoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Caenogastropoda	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Caenogastropoda	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Neogastropoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Caenogastropoda → Neogastropoda	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Buccinoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Caenogastropoda → Neogastropoda → Buccinoidea	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Buccinidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Caenogastropoda → Neogastropoda → Buccinoidea → Buccinidae	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	12.30 %
Unclassified	root	N/A	9.84 %
Cohnella laeviribosi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	4.10 %
Fervidobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	3.28 %
Fervidobacterium thailandense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	3.28 %
Petrotoga sp. HWHPT.55.6.3	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	2.46 %
Mesoaciditoga lauensis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.46 %
Petrotoga mobilis	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	1.64 %
Fervidobacterium nodosum	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	1.64 %
Thermosipho	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Caenogastropoda → Neogastropoda → Buccinoidea → Buccinidae → Thermosipho	0.82 %
Thermoanaerobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	0.82 %
Fervidobacterium pennivorans DSM 9078	strain	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	0.82 %
Aquificaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	0.82 %
Pseudothermotoga elfii	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	0.82 %
Fervidobacterium gondwanense	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	0.82 %
Marinitoga piezophila	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	0.82 %
Tissierellia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001095\|JGI12104J13512_1002926	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	10121	Open in IMG/M
3300009566\|Ga0130025_1138372	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	1244	Open in IMG/M
3300009566\|Ga0130025_1223800	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae	6731	Open in IMG/M
3300009653\|Ga0116169_1004022	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	9421	Open in IMG/M
3300009653\|Ga0116169_1243770	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	593	Open in IMG/M
3300009653\|Ga0116169_1250171	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	584	Open in IMG/M
3300009654\|Ga0116167_1005782	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	8464	Open in IMG/M
3300009654\|Ga0116167_1010514	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales	5355	Open in IMG/M
3300009654\|Ga0116167_1014790	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	4147	Open in IMG/M
3300009654\|Ga0116167_1024193	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	2897	Open in IMG/M
3300009654\|Ga0116167_1036745	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	2151	Open in IMG/M
3300009654\|Ga0116167_1038710	Not Available	2071	Open in IMG/M
3300009654\|Ga0116167_1045577	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	1845	Open in IMG/M
3300009654\|Ga0116167_1126174	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	910	Open in IMG/M
3300009654\|Ga0116167_1188898	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	692	Open in IMG/M
3300009654\|Ga0116167_1192613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacteraceae → unclassified Thermoanaerobacteraceae → Thermoanaerobacteraceae bacterium	683	Open in IMG/M
3300009654\|Ga0116167_1192769	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	682	Open in IMG/M
3300009654\|Ga0116167_1249372	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	575	Open in IMG/M
3300009654\|Ga0116167_1261032	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	558	Open in IMG/M
3300009654\|Ga0116167_1266928	Not Available	550	Open in IMG/M
3300009655\|Ga0116190_1021183	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	3256	Open in IMG/M
3300009655\|Ga0116190_1061407	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	1552	Open in IMG/M
3300009655\|Ga0116190_1124316	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	946	Open in IMG/M
3300009655\|Ga0116190_1303586	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	517	Open in IMG/M
3300009657\|Ga0116179_1047334	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1827	Open in IMG/M
3300009657\|Ga0116179_1205063	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	665	Open in IMG/M
3300009658\|Ga0116188_1014572	All Organisms → cellular organisms → Bacteria	4574	Open in IMG/M
3300009658\|Ga0116188_1036056	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	2411	Open in IMG/M
3300009658\|Ga0116188_1097657	All Organisms → Viruses → Predicted Viral	1175	Open in IMG/M
3300009663\|Ga0116181_1064797	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1577	Open in IMG/M
3300009663\|Ga0116181_1102500	Not Available	1152	Open in IMG/M
3300009664\|Ga0116146_1067578	All Organisms → cellular organisms → Bacteria	1605	Open in IMG/M
3300009682\|Ga0116172_10120022	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1455	Open in IMG/M
3300009710\|Ga0116192_1019881	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	2916	Open in IMG/M
3300009710\|Ga0116192_1066782	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	1298	Open in IMG/M
3300009710\|Ga0116192_1108411	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	949	Open in IMG/M
3300009710\|Ga0116192_1134031	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	829	Open in IMG/M
3300009710\|Ga0116192_1210953	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium pennivorans → Fervidobacterium pennivorans DSM 9078	622	Open in IMG/M
3300009711\|Ga0116166_1051409	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	1826	Open in IMG/M
3300009712\|Ga0116165_1034060	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	2225	Open in IMG/M
3300009712\|Ga0116165_1076306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	1295	Open in IMG/M
3300009714\|Ga0116189_1174793	All Organisms → cellular organisms → Bacteria	781	Open in IMG/M
3300009714\|Ga0116189_1210538	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	689	Open in IMG/M
3300009714\|Ga0116189_1293350	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	555	Open in IMG/M
3300009716\|Ga0116191_1030283	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	2923	Open in IMG/M
3300009761\|Ga0116168_1003176	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	9516	Open in IMG/M
3300009761\|Ga0116168_1097640	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	793	Open in IMG/M
3300010311\|Ga0116254_1150357	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	522	Open in IMG/M
3300010327\|Ga0116246_10000551	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium gondwanense	53536	Open in IMG/M
3300010327\|Ga0116246_10005855	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Mesoaciditogales → Mesoaciditogaceae → Mesoaciditoga → Mesoaciditoga lauensis	9413	Open in IMG/M
3300010327\|Ga0116246_10336823	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	612	Open in IMG/M
3300010338\|Ga0116245_10023519	Not Available	4957	Open in IMG/M
3300010338\|Ga0116245_10027612	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	4380	Open in IMG/M
3300010338\|Ga0116245_10035142	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Marinitoga → Marinitoga piezophila	3646	Open in IMG/M
3300010338\|Ga0116245_10037346	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	3480	Open in IMG/M
3300010338\|Ga0116245_10048652	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	2863	Open in IMG/M
3300010338\|Ga0116245_10112165	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	1596	Open in IMG/M
3300010338\|Ga0116245_10153702	All Organisms → Viruses → Predicted Viral	1293	Open in IMG/M
3300010338\|Ga0116245_10256924	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	933	Open in IMG/M
3300010338\|Ga0116245_10289797	Not Available	866	Open in IMG/M
3300010338\|Ga0116245_10315722	Not Available	821	Open in IMG/M
3300010338\|Ga0116245_10547292	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	585	Open in IMG/M
3300010342\|Ga0116252_10471224	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	714	Open in IMG/M
3300010348\|Ga0116255_10031520	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	4900	Open in IMG/M
3300010348\|Ga0116255_10630449	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	690	Open in IMG/M
3300010353\|Ga0116236_10462075	All Organisms → cellular organisms → Bacteria	1068	Open in IMG/M
3300019203\|Ga0179955_1092681	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	5485	Open in IMG/M
3300019217\|Ga0179946_1009590	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1150	Open in IMG/M
3300019218\|Ga0179954_1110827	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	792	Open in IMG/M
3300019218\|Ga0179954_1139106	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	3673	Open in IMG/M
3300019218\|Ga0179954_1162009	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	3447	Open in IMG/M
3300019218\|Ga0179954_1192081	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	2239	Open in IMG/M
3300019222\|Ga0179957_1251313	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	1281	Open in IMG/M
3300019227\|Ga0179956_1122407	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	604	Open in IMG/M
3300019227\|Ga0179956_1211744	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	613	Open in IMG/M
3300019235\|Ga0179952_1210890	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → unclassified Fervidobacterium → Fervidobacterium sp.	970	Open in IMG/M
3300019235\|Ga0179952_1228427	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	2242	Open in IMG/M
3300019243\|Ga0179953_1052432	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	2415	Open in IMG/M
3300019243\|Ga0179953_1245313	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	662	Open in IMG/M
3300025471\|Ga0209508_1002944	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	10518	Open in IMG/M
3300025589\|Ga0209409_1005782	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	6702	Open in IMG/M
3300025589\|Ga0209409_1007349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5458	Open in IMG/M
3300025589\|Ga0209409_1008882	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium nodosum	4668	Open in IMG/M
3300025589\|Ga0209409_1013971	All Organisms → cellular organisms → Bacteria	3250	Open in IMG/M
3300025589\|Ga0209409_1020337	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium → Fervidobacterium thailandense	2422	Open in IMG/M
3300025589\|Ga0209409_1024848	Not Available	2078	Open in IMG/M
3300025589\|Ga0209409_1092757	All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → unclassified Aquificaceae → Aquificaceae bacterium	772	Open in IMG/M
3300025597\|Ga0208825_1007293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	5257	Open in IMG/M
3300025597\|Ga0208825_1007767	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Caenogastropoda → Neogastropoda → Buccinoidea → Buccinidae → Thermosipho	4989	Open in IMG/M
3300025597\|Ga0208825_1015308	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	2930	Open in IMG/M
3300025597\|Ga0208825_1053211	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	1105	Open in IMG/M
3300025605\|Ga0209720_1004797	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae	8592	Open in IMG/M
3300025605\|Ga0209720_1007655	All Organisms → cellular organisms → Bacteria	6024	Open in IMG/M
3300025605\|Ga0209720_1010964	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	4582	Open in IMG/M
3300025605\|Ga0209720_1026968	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	2220	Open in IMG/M
3300025605\|Ga0209720_1029232	Not Available	2079	Open in IMG/M
3300025605\|Ga0209720_1031787	All Organisms → cellular organisms → Bacteria	1941	Open in IMG/M
3300025605\|Ga0209720_1106645	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	737	Open in IMG/M
3300025605\|Ga0209720_1131141	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	624	Open in IMG/M
3300025609\|Ga0209608_1002427	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	13212	Open in IMG/M
3300025609\|Ga0209608_1003632	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → Petrotoga mobilis	9393	Open in IMG/M
3300025609\|Ga0209608_1018320	All Organisms → cellular organisms → Bacteria	2505	Open in IMG/M
3300025613\|Ga0208461_1004123	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	10384	Open in IMG/M
3300025613\|Ga0208461_1039270	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	1665	Open in IMG/M
3300025618\|Ga0208693_1037065	All Organisms → cellular organisms → Bacteria	1824	Open in IMG/M
3300025618\|Ga0208693_1066807	Not Available	1146	Open in IMG/M
3300025629\|Ga0208824_1146265	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300025631\|Ga0209204_1003729	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	10947	Open in IMG/M
3300025631\|Ga0209204_1007899	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	6056	Open in IMG/M
3300025631\|Ga0209204_1012538	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → Pseudothermotoga → Pseudothermotoga elfii	4151	Open in IMG/M
3300025631\|Ga0209204_1079648	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	971	Open in IMG/M
3300025631\|Ga0209204_1086325	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	913	Open in IMG/M
3300025631\|Ga0209204_1139819	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Petrotogales → Petrotogaceae → Petrotoga → unclassified Petrotoga → Petrotoga sp. HWHPT.55.6.3	627	Open in IMG/M
3300025657\|Ga0208823_1042592	All Organisms → cellular organisms → Bacteria	1778	Open in IMG/M
3300025657\|Ga0208823_1075632	Not Available	1124	Open in IMG/M
3300025678\|Ga0208695_1009549	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	5199	Open in IMG/M
3300025678\|Ga0208695_1099495	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Fervidobacterium	923	Open in IMG/M
3300025683\|Ga0208564_1213935	Not Available	517	Open in IMG/M
3300025691\|Ga0208826_1018275	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Cohnella → Cohnella laeviribosi	3015	Open in IMG/M
3300025772\|Ga0208939_1093629	All Organisms → Viruses → Predicted Viral	1137	Open in IMG/M
3300033817\|Ga0373875_025433	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	826	Open in IMG/M

Habitat	Taxonomy	Distribution
Engineered	Engineered	98.36%
Environmental	Environmental	1.64%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	96.72%
Terrestrial	Environmental → Terrestrial	1.64%
Bioremediation	Engineered → Bioremediation	1.64%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	96.72%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.64%
Terephthalate	Engineered → Bioremediation → Terephthalate	0.82%
Persistent Organic Pollutants (Pop)	Engineered → Bioremediation → Persistent Organic Pollutants (Pop)	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	96.72%
Aquifer	Environmental → Terrestrial → Deep Subsurface → Aquifer	1.64%
Wastewater	Engineered → Bioremediation → Terephthalate → Wastewater	0.82%
Unclassified	Engineered → Bioremediation → Persistent Organic Pollutants (Pop) → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	96.72%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified	1.64%
Unclassified	Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified	0.82%
Unclassified	Engineered → Bioremediation → Persistent Organic Pollutants (Pop) → Unclassified → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	96.72%
Aquifer Solids	Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids	1.64%
Wastewater Bioreactor	Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor	0.82%
Anaerobic Enrichment Culture	Engineered → Bioremediation → Persistent Organic Pollutants (Pop) → Unclassified → Unclassified → Anaerobic Enrichment Culture	0.82%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001095	Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Biofilm	Engineered	Open in IMG/M
3300009566	Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB	Environmental	Open in IMG/M
3300009653	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC130_MetaG	Engineered	Open in IMG/M
3300009654	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG	Engineered	Open in IMG/M
3300009655	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG	Engineered	Open in IMG/M
3300009657	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG	Engineered	Open in IMG/M
3300009658	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG	Engineered	Open in IMG/M
3300009663	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG	Engineered	Open in IMG/M
3300009664	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG	Engineered	Open in IMG/M
3300009682	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG	Engineered	Open in IMG/M
3300009710	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG	Engineered	Open in IMG/M
3300009711	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG	Engineered	Open in IMG/M
3300009712	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG	Engineered	Open in IMG/M
3300009714	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG	Engineered	Open in IMG/M
3300009716	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG	Engineered	Open in IMG/M
3300009761	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC129_MetaG	Engineered	Open in IMG/M
3300010311	AD_JPTRca	Engineered	Open in IMG/M
3300010327	AD_CNMVca	Engineered	Open in IMG/M
3300010338	AD_JPMRca	Engineered	Open in IMG/M
3300010342	AD_JPNAca1	Engineered	Open in IMG/M
3300010348	AD_HKYLca	Engineered	Open in IMG/M
3300010353	AD_USCAca	Engineered	Open in IMG/M
3300019203	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR2_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019217	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019218	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNMR3_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019222	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019227	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR3_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019235	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNMR1_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019243	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNMR2_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300025471	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC129_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025589	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025597	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025605	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025609	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC130_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025613	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025618	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025629	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025631	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025657	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025678	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025683	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025691	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025772	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG (SPAdes)	Engineered	Open in IMG/M
3300033817	Laboratory-enriched microbial communities from a contaminated site in Ontario, Canada - KB1_TCB MSP	Engineered	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12104J13512_10029261	3300001095	Wastewater Bioreactor	VNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYERLFKCSIE*
Ga0130025_11383722	3300009566	Aquifer Solids	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV*
Ga0130025_12238004	3300009566	Aquifer Solids	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV*
Ga0116169_100402211	3300009653	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVNKLSESS*
Ga0116169_12437703	3300009653	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVK*
Ga0116169_12501711	3300009653	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIILF*
Ga0116167_100578210	3300009654	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVLQVR*
Ga0116167_10105145	3300009654	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYWPVLKD*
Ga0116167_10147901	3300009654	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL*
Ga0116167_10241933	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYYLSG*
Ga0116167_10367455	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYVDGR*
Ga0116167_10387101	3300009654	Anaerobic Digestor Sludge	VCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYIKNS*
Ga0116167_10455773	3300009654	Anaerobic Digestor Sludge	NDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVSLAKKQLR*
Ga0116167_11261742	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVTLNFSNQLP*
Ga0116167_11888982	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVDYRKIKNI*
Ga0116167_11926131	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVKQV*
Ga0116167_11927691	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVTLSTVPWRN*
Ga0116167_12493721	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSS*
Ga0116167_12610321	3300009654	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYVLLG*
Ga0116167_12669281	3300009654	Anaerobic Digestor Sludge	VNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIIVVLIYQ*
Ga0116190_10211831	3300009655	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV*
Ga0116190_10614072	3300009655	Anaerobic Digestor Sludge	AGVNILDRDAEETTEAIPSSVHLDFTLARVTLNFSNQLP*
Ga0116190_11243161	3300009655	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIIVVLIYQ*
Ga0116190_13035861	3300009655	Anaerobic Digestor Sludge	DKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYRLLER*
Ga0116179_10473341	3300009657	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVIWL*
Ga0116179_12050631	3300009657	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIILF*
Ga0116188_10145726	3300009658	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVKT*
Ga0116188_10360563	3300009658	Anaerobic Digestor Sludge	VCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY*
Ga0116188_10976571	3300009658	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVTLNFSNQLP*
Ga0116181_10647971	3300009663	Anaerobic Digestor Sludge	QSDVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV*
Ga0116181_11025002	3300009663	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSLNKL*
Ga0116146_10675782	3300009664	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVF*
Ga0116172_101200222	3300009682	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYSTI*
Ga0116192_10198814	3300009710	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYYFY*
Ga0116192_10667821	3300009710	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVSHIQKRS*
Ga0116192_11084113	3300009710	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVCIENV*
Ga0116192_11340312	3300009710	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYVDGR*
Ga0116192_12109532	3300009710	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVFFFLI*
Ga0116166_10514091	3300009711	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY*
Ga0116165_10340601	3300009712	Anaerobic Digestor Sludge	KVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL*
Ga0116165_10763061	3300009712	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVIDNHIISCYN*
Ga0116189_11747932	3300009714	Anaerobic Digestor Sludge	NDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY*
Ga0116189_12105382	3300009714	Anaerobic Digestor Sludge	AGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL*
Ga0116189_12933501	3300009714	Anaerobic Digestor Sludge	VNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSS*
Ga0116191_10302834	3300009716	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYYFY*
Ga0116168_100317611	3300009761	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVNKLSESS*
Ga0116168_10976403	3300009761	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVK*
Ga0116254_10707691	3300010311	Anaerobic Digestor Sludge	KVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV*
Ga0116254_11503572	3300010311	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYYVYSNS*
Ga0116246_100005511	3300010327	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARV*
Ga0116246_1000585511	3300010327	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVNKLSESS*
Ga0116246_103368231	3300010327	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIILF*
Ga0116245_100235195	3300010338	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSFKILSYL*
Ga0116245_100276121	3300010338	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL*
Ga0116245_100351421	3300010338	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYVDGR*
Ga0116245_100373463	3300010338	Anaerobic Digestor Sludge	VVCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYIKNS*
Ga0116245_100486521	3300010338	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYYFY*
Ga0116245_101121651	3300010338	Anaerobic Digestor Sludge	NDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVDYRKIKNI*
Ga0116245_101537021	3300010338	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVTLNFSNQLP*
Ga0116245_102569241	3300010338	Anaerobic Digestor Sludge	KVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIIVVLIYQ*
Ga0116245_102897972	3300010338	Anaerobic Digestor Sludge	DVVCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY*
Ga0116245_103157222	3300010338	Anaerobic Digestor Sludge	VNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVKINFL*
Ga0116245_105472922	3300010338	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSS*
Ga0116252_104712242	3300010342	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVS*
Ga0116255_100315205	3300010348	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARV*
Ga0116255_106304491	3300010348	Anaerobic Digestor Sludge	VNWAGVNILDGDAEETTEPIPSSVHLDFTLARVYVDGR*
Ga0116236_104620751	3300010353	Anaerobic Digestor Sludge	DKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVSLW*
Ga0179955_10926811	3300019203	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLNFTLARV
Ga0179946_10095903	3300019217	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Ga0179954_11108272	3300019218	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVTLSTVPWRN
Ga0179954_11391064	3300019218	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTDKPLYHTGHS
Ga0179954_11620094	3300019218	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVPSLLPHLS
Ga0179954_11920814	3300019218	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL
Ga0179957_12513131	3300019222	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVTLNFSNQLP
Ga0179956_11224071	3300019227	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Ga0179956_12117441	3300019227	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVTLSTVPWRN
Ga0179952_12108902	3300019235	Anaerobic Digestor Sludge	VNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVPKTLYTTIL
Ga0179952_12284274	3300019235	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL
Ga0179953_10524323	3300019243	Anaerobic Digestor Sludge	VVCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY
Ga0179953_12453132	3300019243	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVSLAKKQLR
Ga0209508_10029441	3300025471	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Ga0209409_10057821	3300025589	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSS
Ga0209409_10073497	3300025589	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Ga0209409_10088821	3300025589	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTYSMPTNL
Ga0209409_10139714	3300025589	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYYLSG
Ga0209409_10203371	3300025589	Anaerobic Digestor Sludge	DVVCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY
Ga0209409_10248482	3300025589	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYIKNS
Ga0209409_10927573	3300025589	Anaerobic Digestor Sludge	EVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVNRVCHSF
Ga0208825_10072931	3300025597	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYILITG
Ga0208825_10077671	3300025597	Anaerobic Digestor Sludge	VVCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Ga0208825_10153081	3300025597	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYYFY
Ga0208825_10532113	3300025597	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVCIENV
Ga0209720_100479710	3300025605	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVLQVR
Ga0209720_10076551	3300025605	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVTLNFSNQLP
Ga0209720_10109645	3300025605	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYWPVLKD
Ga0209720_10269681	3300025605	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVF
Ga0209720_10292322	3300025605	Anaerobic Digestor Sludge	VVCEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYIKNS
Ga0209720_10317871	3300025605	Anaerobic Digestor Sludge	DKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARV
Ga0209720_11066452	3300025605	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYRLLER
Ga0209720_11311411	3300025605	Anaerobic Digestor Sludge	NDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVSLAKKQLR
Ga0209608_10024271	3300025609	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYKTI
Ga0209608_10036321	3300025609	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVNKLSESS
Ga0209608_10183201	3300025609	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARV
Ga0208461_10041239	3300025613	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTDKPLYHTGHS
Ga0208461_10392701	3300025613	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIIVVLIYQ
Ga0208693_10370654	3300025618	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIILF
Ga0208693_10668072	3300025618	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSLNKL
Ga0208824_11462652	3300025629	Anaerobic Digestor Sludge	NDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVY
Ga0209204_100372910	3300025631	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYTDKPLYHTGHS
Ga0209204_10078999	3300025631	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSS
Ga0209204_10125381	3300025631	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVL
Ga0209204_10796482	3300025631	Anaerobic Digestor Sludge	WAGVNILDRDAEETTEAIHSSVHLDFTLARVYWPVLKD
Ga0209204_10863251	3300025631	Anaerobic Digestor Sludge	WAGVNILDRDAEETTEAIPSSVHLDFTLARVYIIVVLIYQ
Ga0209204_11398192	3300025631	Anaerobic Digestor Sludge	VYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYVDGR
Ga0208823_10425924	3300025657	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIILF
Ga0208823_10756322	3300025657	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVSLNKL
Ga0208695_10095491	3300025678	Anaerobic Digestor Sludge	NWAGVNILDRDAEETTEAIHSSVHLDFTLARVYILITG
Ga0208695_10994951	3300025678	Anaerobic Digestor Sludge	YEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVCIENV
Ga0208564_12139351	3300025683	Anaerobic Digestor Sludge	VNDKVNWAGVNILDRDAEETTEAIPSSVHLDFTLARVYIILF
Ga0208826_10182755	3300025691	Anaerobic Digestor Sludge	DVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVYYFY
Ga0208939_10936291	3300025772	Anaerobic Digestor Sludge	VVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVTDILLIRYL
Ga0373875_025433_673_825	3300033817	Anaerobic Enrichment Culture	QSDVVYEVNDKVNWAGVNILDRDAEETTEAIHSSVHLDFTLARVDKKYPN

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F070782

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign