NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070785

Metagenome / Metatranscriptome Family F070785

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070785
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 117 residues
Representative Sequence MLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRGMQ
Number of Associated Samples 89
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.10 %
% of genes near scaffold ends (potentially truncated) 46.72 %
% of genes from short scaffolds (< 2000 bps) 99.18 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(72.131 % of family members)
Environment Ontology (ENVO) Unclassified
(92.623 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(83.607 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.79%    β-sheet: 21.05%    Coil/Unstructured: 38.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005347|Ga0070668_100661348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum919Open in IMG/M
3300005618|Ga0068864_102020908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300005841|Ga0068863_102482457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300009553|Ga0105249_12725590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300009973|Ga0105136_103914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300009980|Ga0105135_107940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum764Open in IMG/M
3300009981|Ga0105133_115839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii626Open in IMG/M
3300009994|Ga0105126_1022808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300010399|Ga0134127_10988192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum901Open in IMG/M
3300010403|Ga0134123_11348003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum751Open in IMG/M
3300010403|Ga0134123_11422380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum734Open in IMG/M
3300015270|Ga0182183_1086404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300015278|Ga0182099_1037945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300015284|Ga0182101_1021439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii827Open in IMG/M
3300015284|Ga0182101_1025194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300015284|Ga0182101_1061175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015290|Ga0182105_1010651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1045Open in IMG/M
3300015290|Ga0182105_1047323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum671Open in IMG/M
3300015293|Ga0182103_1016308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum883Open in IMG/M
3300015301|Ga0182184_1010845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1039Open in IMG/M
3300015301|Ga0182184_1021729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum837Open in IMG/M
3300015301|Ga0182184_1077812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015306|Ga0182180_1024827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum815Open in IMG/M
3300015309|Ga0182098_1034039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300015311|Ga0182182_1012714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1054Open in IMG/M
3300015312|Ga0182168_1025176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum917Open in IMG/M
3300015313|Ga0182164_1138396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300015315|Ga0182120_1087445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300015316|Ga0182121_1021413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1014Open in IMG/M
3300015316|Ga0182121_1085542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300015317|Ga0182136_1007121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1331Open in IMG/M
3300015317|Ga0182136_1092519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
3300015317|Ga0182136_1137548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015318|Ga0182181_1019316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum914Open in IMG/M
3300015318|Ga0182181_1088670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii553Open in IMG/M
3300015319|Ga0182130_1080524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015320|Ga0182165_1124500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300015324|Ga0182134_1042926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii796Open in IMG/M
3300015325|Ga0182148_1023995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii939Open in IMG/M
3300015326|Ga0182166_1000511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2516Open in IMG/M
3300015326|Ga0182166_1015030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1067Open in IMG/M
3300015326|Ga0182166_1052700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii729Open in IMG/M
3300015327|Ga0182114_1047333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum812Open in IMG/M
3300015329|Ga0182135_1031904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum895Open in IMG/M
3300015329|Ga0182135_1060489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum721Open in IMG/M
3300015330|Ga0182152_1021232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1022Open in IMG/M
3300015332|Ga0182117_1035887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum926Open in IMG/M
3300015332|Ga0182117_1071488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum721Open in IMG/M
3300015332|Ga0182117_1151732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300015334|Ga0182132_1091651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300015334|Ga0182132_1109305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300015335|Ga0182116_1006610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1572Open in IMG/M
3300015335|Ga0182116_1141471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300015336|Ga0182150_1113156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300015336|Ga0182150_1167589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300015337|Ga0182151_1074797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300015338|Ga0182137_1054354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum819Open in IMG/M
3300015338|Ga0182137_1064101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum770Open in IMG/M
3300015338|Ga0182137_1155133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300015339|Ga0182149_1128610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300015348|Ga0182115_1181492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015348|Ga0182115_1226393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii597Open in IMG/M
3300015348|Ga0182115_1301542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015349|Ga0182185_1217956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015349|Ga0182185_1277203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015350|Ga0182163_1257539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300015352|Ga0182169_1236981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300015353|Ga0182179_1022593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1503Open in IMG/M
3300015353|Ga0182179_1033662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1310Open in IMG/M
3300015354|Ga0182167_1061312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1318Open in IMG/M
3300015354|Ga0182167_1119368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum970Open in IMG/M
3300015354|Ga0182167_1276326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300017408|Ga0182197_1078028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300017414|Ga0182195_1011935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1390Open in IMG/M
3300017414|Ga0182195_1100718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300017422|Ga0182201_1108103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii558Open in IMG/M
3300017435|Ga0182194_1051692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum753Open in IMG/M
3300017439|Ga0182200_1042854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum798Open in IMG/M
3300017439|Ga0182200_1103000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300017445|Ga0182198_1177613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300017446|Ga0182217_1073815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum796Open in IMG/M
3300017447|Ga0182215_1042075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum965Open in IMG/M
3300017691|Ga0182212_1066128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum799Open in IMG/M
3300017693|Ga0182216_1053847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum873Open in IMG/M
3300017693|Ga0182216_1120597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300017693|Ga0182216_1135266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300017694|Ga0182211_1125778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300020023|Ga0182178_1003110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum974Open in IMG/M
3300025931|Ga0207644_10987409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum707Open in IMG/M
3300025972|Ga0207668_10585290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum971Open in IMG/M
3300028052|Ga0268300_1006941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300028053|Ga0268346_1011986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum755Open in IMG/M
3300028055|Ga0268338_1023496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300028056|Ga0268330_1020590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum742Open in IMG/M
3300028058|Ga0268332_1029539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum716Open in IMG/M
3300028062|Ga0268342_1019192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300028062|Ga0268342_1020448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum654Open in IMG/M
3300028141|Ga0268326_1000547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1336Open in IMG/M
3300028147|Ga0268303_107150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300028152|Ga0268336_1010347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum701Open in IMG/M
3300028248|Ga0268312_1012859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum709Open in IMG/M
3300028253|Ga0268316_1010202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300028262|Ga0268310_1012141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum808Open in IMG/M
3300028262|Ga0268310_1047170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300028467|Ga0268333_1012616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300028468|Ga0268317_1007095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300028468|Ga0268317_1008269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum578Open in IMG/M
3300028470|Ga0268307_1003416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum896Open in IMG/M
3300028474|Ga0268331_1015965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300028475|Ga0268327_1015266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300028476|Ga0268329_1010745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
3300032465|Ga0214493_1078235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300032490|Ga0214495_1117733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii603Open in IMG/M
3300032502|Ga0214490_1131582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300032551|Ga0321339_1084385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum729Open in IMG/M
3300032625|Ga0214501_1189443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii655Open in IMG/M
3300032689|Ga0214497_1015915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1489Open in IMG/M
3300032761|Ga0314733_1109440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum514Open in IMG/M
3300032791|Ga0314748_1085366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300032915|Ga0314749_1089655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum662Open in IMG/M
3300033523|Ga0314768_1252419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300033539|Ga0314762_1064424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum687Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere72.13%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere17.21%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated3.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028052Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028147Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028470Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028475Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028476Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033539Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070668_10066134813300005347Switchgrass RhizosphereMLYCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFCRASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0068864_10202090823300005618Switchgrass RhizosphereMLHCSFNFHNIIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGD
Ga0068863_10248245723300005841Switchgrass RhizosphereMLHYSFNFHNVIITFQDLIDGEYTIVAVSFWAILNQVMDNLGLTYMGGEPYFTRDLRFQAKLSFCRESQSNTPLFDICGSICGRHWETEESAPFRALVYFDEVLGWTI
Ga0105249_1272559013300009553Switchgrass RhizosphereLIDGESTITAVSFRAILNQVLGYLGLTYMGGGPFLTRDLRFQAKLSFYWTSQLNTPLFDICSSICGRHWEAEESALVRALVYFDEILGWTIGDLNYLKYL*
Ga0105136_10391413300009973Switchgrass AssociatedMHCSFNFHNVIITFLQDLIDHQYIIASVSFWAILNQVMDTLGLTCMGGEPYFTRGCRFQAKLSFCRASQPNTPLFDICSSLFVHQWEAEESALVRALAYFDEVLGWTIGDRNYFIYLRMRAMQ*
Ga0105135_10794013300009980Switchgrass AssociatedLHYSFTFHNVIITFQDLIDGEYTIIAVSFRAILNQFMDTLGLSCIGGEPYFTRYLRFQAKLSFCRASQPNTLLFDICSSICGRHWEAEESALVRALVYFDEVLGWTIGNCNYLIYLRMQAMQ*
Ga0105133_11583913300009981Switchgrass AssociatedMLHYSFNFHNVIITFLQDQYTIASVSFRNILNQVMDTLGLTCMGGEPYFTRGCRFQAKLSFCRANQPNTPLFDICSSICAHQWEAEESALVRALVYFDEVLGWMIGDRNYLIYLRMQAMR
Ga0105126_102280813300009994Switchgrass AssociatedMRFSLQSLLTLVMLHYSFNFHNTIITFQLIDGEYTIAAVSFRAILNQIIDTLGLICMGGEPYFTRDCRFQAKLSFCRASQPNTPLFDICSSVCGSHWEAEESALVRALVYFDEVLGWTIEDHNYLIYLRMRVML*
Ga0134127_1098819223300010399Terrestrial SoilMLHCSFNFHNVIITFLHDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0134123_1134800313300010403Terrestrial SoilMLHCSFNFHNVIIIFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGDPHFTRSSRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0134123_1142238023300010403Terrestrial SoilMLHYSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTCISGEPYFTRGCRFQAKLFFCRASQSNTLLFDICSSMCGHQWEAEESALVHALVYFVEVLGWTIGDRN
Ga0182183_108640413300015270Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTCMGGEPYFTRGCRFQAKLSFCRASQPNTPLFDICSSICAHQWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRM
Ga0182099_103794523300015278Switchgrass PhyllosphereLYYSFNFHNVIITFQDLIDGEYTIAAVSFRAILNQVMDNLGLTYMGGEPYFTRDLRFQAKLSFCKASQPNTPLFDICSSICGRHWEAEESALVRALIYFDEVL
Ga0182101_102143913300015284Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNQLFDICSSICGRHWEVEESALVRALVYFDEVLGWMIGDLNYLIYLQLQAFR*
Ga0182101_102519413300015284Switchgrass PhyllosphereMLHYFFNFHNVIITFQDLIDGESTIVAVSFRAILNQVMDYLGLTYMGGEPFFNRDLRFQAKLSFCKASQHNTPLFDICSSICGRHWEAEESALVRTLVYFDEVLGWMETLN*
Ga0182101_106117513300015284Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRGMQ*
Ga0182105_101065113300015290Switchgrass PhyllosphereMLYYSFKFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTCMGGEPYFTRDFRFQAKLSFCGASQPNTPLFDICSSICAHQWEVEESALVHALVYFDEVLGWTI*
Ga0182105_104732313300015290Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPRFLHNCKFQAKLCFYRASQLNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRVMQ*
Ga0182103_101630813300015293Switchgrass PhyllosphereLHYSFNFHNVIITFQDLIDEEYMIAAVSLRAILNQVIDTLGLTCMAGEPYFTRDLRFQAKLSFCRASQPNTLLFDICSSICGRHWEAEESALVHALVYFDEVLGWTIGNSKYL
Ga0182184_101084513300015301Switchgrass PhyllosphereMLHCSFNFHNVIITFQDVINGEFTIAAVSFRAILNQVMDNFSLTYMGGEPYFIRDLRFQSKLSFCRTSQHNTPLFNICSSICGRHWEAEESALVRVLVYFDEVLGWTIGDLNYLIYLRLRAFQ*
Ga0182184_102172913300015301Switchgrass PhyllosphereVIITFLQDLIDHQYTIASVSFWDILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCRASQLNTPLFDICSSICNNEWEAEESALVHALAYFDDVLGWTIGDCNYLIYLRMRAMQ*
Ga0182184_107781213300015301Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFWAILNQVMENLGLTYMGGEPYFRRDCKFQAKLSFFRASHPNTPLFDISSPICGRQWETEESALIRALVYFDE
Ga0182180_102482713300015306Switchgrass PhyllosphereSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCKASQLSTPLFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRIR*
Ga0182098_103403913300015309Switchgrass PhyllosphereMYYPFNFHNVIITFQDLIDGEYTIAAVSFRAILNQVMDNLGLTYMGGEPCFKRDLRFQAKLSFCRASQPNTPLFDICSSICGRHWEAEESALVRALVYFDEVLD*
Ga0182182_101271413300015311Switchgrass PhyllosphereLYYSFNFHNVIITFQDLIDGEYTIAAVSFRAIPNQVMDNLGLTFMSGEPYFTRDLRFQAKLSFCKASQPNTPLFDICSSICGRHWEAAESALFRALIYFDEVLGWTIGDLNYLRYVRLREFQ*
Ga0182168_102517613300015312Switchgrass PhyllosphereTIVAVSFRAILNQVMDNLGLTYMGGEPYFTRDLRFQVKLSFCRESQSNTPLFDICGSICGRHWETEESAPFRALVYFDEVLGWTIGDLNYLRYLRLRAFQ*
Ga0182164_113839613300015313Switchgrass PhyllosphereMLHCSFNFHDVIITYLQDLIDHQYTISSVSFRAILNQVVDTLGLTWMGGEPRFLHNCKFQAKLSFCRASQLNTPLFDICSSICNNEWEAEESALVRALAYFDEVL
Ga0182120_108744513300015315Switchgrass PhyllosphereMLHYSFNFHNVIITFQDVINGEFTIAAVSFRAILNQVMDNLGLTYMGGEPCFKRDLRFQAKLSFCRASQPNTPLFDICSSICGRHWEAEESALVRALVYFDEVLGWTIGDLNYLRYLQLRAFQ*
Ga0182121_102141313300015316Switchgrass PhyllosphereMLLSPCLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCKASQLSTPLFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYL*
Ga0182121_108554213300015316Switchgrass PhyllosphereMLHSFNFHNVIITFLQDLIDHQYTITSVSFQAILNQVMDTLGLTCMGGGPYFTRGCRFQAKLFFCRASQSNTLLFDICSSMCGHQWEAEESALVHALVYFVEVLGWTIGDRNYLI
Ga0182136_100712113300015317Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYL*
Ga0182136_109251913300015317Switchgrass PhyllosphereLHYSFNFHNVIITFQDLIDGEYTIAVVSFRAILSQVMDTLGLTCMGGEPYFTRDFRFQAKLSFCRASQPNTPLFHICSSICGRHWEVEESALVRALVYFDEVLGWTIGDLNYLRYVRLRAFQ*
Ga0182136_113754813300015317Switchgrass PhyllosphereGEYTIAAVSFRAIPNQVMDNLGLTFMSGEPYFTRDLRFQAKLSFCKASQPNTPLFDICSSICGRHWEAAESALFRALIYFDEVLGWTIRYHNYLVYLRMRAMQ*
Ga0182181_101931613300015318Switchgrass PhyllosphereNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCKASQLNTPLFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDPNYLIYL*
Ga0182181_108867013300015318Switchgrass PhyllosphereHCSFNFHNVIITFLQDLIDHQYTIASVSFYAILNQVVDTLGFTWMGGDPHFTRSCRFQAKLSFCRASQPNNQLFDICSSICGRHWEEEESALVRALIYFDEVLGWTIGDLNYLRYVRLRAFQ*
Ga0182130_108052413300015319Switchgrass PhyllosphereLLTLHYFFNFHNIIITFQDLIDGEYTIAAVSFRAIPSQVMDTLGLTCMGGEPYFTRSCRFQAKLSFCRASQPNTLLFDICISICGNKWEAEESALVRALAYFDEVLGWTIGDRNYL
Ga0182165_112450013300015320Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVLDYLGLTYMGGEPFFTRDFNFQAKLSFRRTSQLNTPLFDICSSICWEAEESALVRALAYFDEVLRWTIGDRNYLIYLRMRAM
Ga0182134_104292613300015324Switchgrass PhyllosphereMLHYSFNFHNVIITFQDLIDGEYTIVAVSFRAILNQVMDNLGLTYMGGEPYFTRDLRFQAKLSFCKASQPNTPLFDICSSICGRHCEAEESALVRALIYFDEVLGWMIGDLNYLRYVRLRAFQ*
Ga0182148_102399513300015325Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKISFCRASQPNNKLFDICSSIRGRHWEVEESALVRALVYFDEVLGWTIGDLNYLIYLRLRAFQ*
Ga0182166_100051133300015326Switchgrass PhyllosphereMLHYFFNFHNVIITFLQDLIDHQYTIASISFRAILNQVVDTLGLTYICGEPNFTRDLRFQAKLSFCRASQPNNQLFDICSSICGRHWEVEESALVRALVYFDEVLGWTIGDLNYLIYLRLRAFQ*
Ga0182166_101503013300015326Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTWMGGDPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0182166_105270013300015326Switchgrass PhyllosphereHYSFNFHNIIITFQDFIDGESTIAAVSFRAILNQVMDYLGLTYMGGEPFFTRDLRFQAKISFCRTSQIDTRLFHICSTICGRYWEAEESALVRALVYFDEILGWMIGDLNYLSYL*
Ga0182114_104733323300015327Switchgrass PhyllosphereTIASVSFRAILNQVVDTLGLTWMGREPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0182135_103190413300015329Switchgrass PhyllosphereLTLVMLHYSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCRASQLNTPFFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0182135_106048923300015329Switchgrass PhyllosphereMLHYFFNFHNVIITFQDLIDGESTIAAVSFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNQLFNICSSIRGRHWEVEESALVHALVYFDEVLGWTIGDLNYLIYLRL*
Ga0182152_102123213300015330Switchgrass PhyllosphereVMLHCSFNFHNVIITFLQDLIDHQYTIVSVSFQAILNQVVDTLGLTWMGGEPRFLHNCKFQAKLSFCRASQLNTPLFDICSSICNNEWEADESALVRALAYFGEVLGWTIGDRNYLIYLRMRVMQ*
Ga0182117_103588733300015332Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFCRASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLWMRAMQ*
Ga0182117_107148813300015332Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNKLFDICSSIRGRHWEVEESALVRALVYFDEILGWTIGDLNYLIYLRLRAFQ*
Ga0182117_115173213300015332Switchgrass PhyllosphereMRFSLQSLLTLVMLHYSFNFHNTIITFQLIDGEYTIAAVSFRAILNQIIDTLGLICMGGEPYFTRDCRFQAKLSFCRASQPNTPLFDICSSVCGSHWEAEESALVRALVYFDEVLGWTIEDHNYLIYLRMRAML*
Ga0182132_109165113300015334Switchgrass PhyllosphereMLHYFFNFHNVIITFQDLIDGESTIAAVSFRAILNQVMDYLGLTYMGGEPFFNRDLRFQAKLSFCRTSQSNTPLFDICSSICGSYWKAEQSALVRALVYFDEVLG*
Ga0182132_110930513300015334Switchgrass PhyllosphereMLHYSFNFHNIIITFLQDLVHNQYTIASVSFRAILNQVVDTLGLTCMGGEPHFTRSCRFQAKLSFCRASQPNTPLLDICSSICGNEWEAEESVLVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0182116_100661033300015335Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNFSLTYMGGEPYFTRDLRFQSKLSFCRTCQHNTPLFNICSSICGRHWEAEESALVRAIVYFDEVLGWTIRDLNYF
Ga0182116_114147113300015335Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTFGLTWMGGEPRFLHNCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYL*
Ga0182150_111315613300015336Switchgrass PhyllosphereLLTLVILHYSFNFHNIIITFQDLIDGEYTIIAVSFRAILNQFMDTLGLTCIGGEPYFTRDLRFQAKLFFCRASQPNTLLFDIYSSICGRHWEAEESALVRALVYFDEVLGWTIGNCNYLIYLRMRAMQ*
Ga0182150_116758923300015336Switchgrass PhyllosphereMLHYSFNFHNVIITFQDLIDGEYTIVAVSFRVILNQVMDNLGLTYMGREPYFTRDLRFQVKLSFCRESQSNTPLFDICGSICGRHWETEESAPFRALVYF
Ga0182151_107479723300015337Switchgrass PhyllosphereCIILSTFIMLLSPFCRISFDHQYTIPSVSFRAILNQVMDTLGLTCISGEPYFTRGCRFQAKLFFCRASQSNTLLFDICSSMCGHQWEAEESALVHALVYFVEVLGWTIGDRNYLIYLRMRATQ*
Ga0182137_105435413300015338Switchgrass PhyllosphereMLYYSFNFHNAIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCKASQPNNQLFDICSSIRGRHWEVEESALVRALVYFDEVLGWTIGDLNYLIYLRLRAFQ*
Ga0182137_106410113300015338Switchgrass PhyllosphereFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLIWMGGEPCFLHNCKFQAKLSFCRASQLNTPLFDICSSICNNEWEAEESALVRALAYFDEVLGWTIRDRNYLIYLRLRAMQ*
Ga0182137_115513313300015338Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPITPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRGMQ*
Ga0182149_112861023300015339Switchgrass PhyllosphereMLYYSFNFHNVIITFQGLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNQLFDICSSIRGRHWEVEESALVRALVYFDE
Ga0182115_118149213300015348Switchgrass PhyllosphereMLHYSFNSHNVIITFQDLINGESTIAEFSFRAILNQVMDNLGLTHMGGVPLFTRDLRFQAKLSFCRKSQANTPLFDICSSICGRHWEAEESALVRALVYFDEVLD*
Ga0182115_122639313300015348Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNKLFDICSSICGRHWEVEESALVRALVYFDEVLGWTIGDLNYLIYLRLRAFQ*
Ga0182115_130154213300015348Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFCRASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLG
Ga0182185_121795613300015349Switchgrass PhyllosphereMLHYSFNFHNVIITFLQDLVDHQYTIASVSFWAILNQVMDTLGLTYMGGEPYFTRDLRFQIKLSFCRESQSNTPLFDICGSICGRHWEAEESAVVRALAYFDEVLGWTIGGRNYLIYPRMRAMQ*
Ga0182185_127720313300015349Switchgrass PhyllosphereYTIAAVSFRAILNQVMDTLGLTCIVGGTYFTRGCKFQAKLSFCRASQPNTLLFDICSSICGSHWEAEKSALVPALVYFDEVIGWTIRDHNYLVYLRMRAMQ*
Ga0182163_125753913300015350Switchgrass PhyllosphereMLHYSFNFRNVIITFQDLIDGEYTISAVSFRAILNQVMDNLGLTYMGGEPCFKRDLRFQAKLSFCRASQPNTPLSDICSSICGRHWEAEESALARALVYFDEVIGWTIEDPNYLRYLWLRAFQ*
Ga0182169_123698113300015352Switchgrass PhyllosphereLLTSAILFYSFNFHNVIITFQDLIDGEYTIAAVSFRAIPNQVMDNLGLTFMSGAPYFTRDLRFQTKLSFCRVSQQNTPLFDICCSICGRHWEAEESAVVRAL
Ga0182179_102259313300015353Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNQLFDICSSIRGRHWEVEESALVRALVYFDEVLGWTIGDLNYLRYLQLRAFQ*
Ga0182179_103366213300015353Switchgrass PhyllosphereTIAAVSFRAILNQVMDNFSLTYMGGEPYFTRDLRFQSKLSFCRTSQHNTPLFNICSSICGRHWEAEESALVRAIVYFDEVLGWTIRDLNYFRYLQLRAFQ*
Ga0182167_106131223300015354Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNQLFNICSSIRGRHWEVEESALVHALVYFDEVLGWTIGDLNYLIYLRLRAFQ*
Ga0182167_111936823300015354Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFCTASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ*
Ga0182167_127632613300015354Switchgrass PhyllosphereVTSFKFHNVIITFQDLIDSEYTIAAVSFRAILNQVMDNLGLTYMGGEPYFTRDLRFQVKLSFCRESQSNTPLFDICGSICGRHWETEESAPFRALVYFDEVLGWTIEDLNYLRYLRLRAFQ*
Ga0182197_107802823300017408Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWESEESALVRALAYFDEVLGWIIGDRNYLIYLCNWRPQLSYLSM
Ga0182195_101193513300017414Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFYRASQPNNQLFDICSSIRGRHWEVEESALVHALVYFDEVLGWTIGDLNYLIYLRLRAFQ
Ga0182195_110071823300017414Switchgrass PhyllosphereFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTCIEPYFTRGCRFQAKLSFYRTSQRSTPLFDICSSICGHQWEAEESALVRALVYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0182201_110810313300017422Switchgrass PhyllosphereMLHYFFNFHNVIITFQDLIDGEYTIAVVSFRAILNQVMDTLGLTCMGGEPYFTRGFRFQAKLSFCRASQPNTPLFDICSSLCGHQWEAEESALVRALVYFDEVLGWTIGDRNYFIYLRMRAMQ
Ga0182194_105169213300017435Switchgrass PhyllosphereMLHCSFNFHDVIITYLQDLIDHQYTISSVSFRAILNQVVDTLGLTWMGGEPRFLHNCKFQAKLSFCRASQLNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRVMQ
Ga0182200_104285413300017439Switchgrass PhyllosphereMLYYSFKFHNVIITFLQDLIDHQYTIASISFRAILNQVMDTLGLTCMGGEPYFTRGCRFQAKLSCGASQPNTPLFDICSSLCGHQWEAEESALVRALVYFDEVLG
Ga0182200_110300013300017439Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFYRASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYPRMQEMQ
Ga0182198_117761313300017445Switchgrass PhyllospherePFNFDNIIITFLQDLVDHQYIIASVNFRAILNQVMDTLGLTCMGGEPYFTRDFRFQAKLSFCRASQPNTPLLDICSSICGRHWEAEESALARALIYFDEVLGWTIGDRNYFIYLRMRAMQ
Ga0182217_107381523300017446Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTSLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAML
Ga0182215_104207523300017447Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCKASQLNTPLFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0182212_106612813300017691Switchgrass PhyllosphereFCRISFDHQYTIASVSFRAILNQVVDTFGLTWMGGEPRFLHNCKFQAKLSFCRASQLNTPLFDICSSICNNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRIR
Ga0182216_105384713300017693Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHKYTIVSVSFRAILNQVMDTLGLTCMGGEPYFTRDFKFQAKLSFCRASQLNTPLFDICSSICNNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLQMRVMQ
Ga0182216_112059713300017693Switchgrass PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKISFCRASQPNNKLFDICSSIRGRHWEVEESALARALVYFDEVIGWTFGDPNYLRY
Ga0182216_113526623300017693Switchgrass PhyllosphereTIASVSFRAILNQVMDTLGLTCMGGEPYFTRSCRFQAKLSFCRASQPNTPLFDICSSICGHEWEVEESALVHALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0182211_112577813300017694Switchgrass PhyllosphereTLVMLHCSFNFHNVIITFLQDLIDHQYTIASVSFQAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLGWMIGDRNYLIYLRMRAMQ
Ga0182178_100311023300020023Switchgrass PhyllosphereMLLSPFCRISFDHQYTIASVSFRAILNQVVDTLGLTWMGGDPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLWMRAMQ
Ga0207644_1098740923300025931Switchgrass RhizosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGDPHFTRSCRFQAKLSFCRASQPNNQLFDICSSICAHQWEAEESALVRALVYFDEVLG
Ga0207668_1058529013300025972Switchgrass RhizosphereIHVHQEVGLPLGDLIDHQYTITSVSFQAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0268300_100694123300028052PhyllosphereVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCRASQLNTPFFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0268346_101198613300028053PhyllosphereTLVMLHYSFNFHNTIITFQLIDGEYTIAAVSFRAILNQIIDTLGLICMGGEPYFTRDCRFQAKLSFCRASQPNTPLFDICSSVCGSHWEAEESALVRALVYFDEVLDWKIGDLNYLRYLQLRAFH
Ga0268338_102349613300028055PhyllosphereSTRQSMRFSFMSLLTLVMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPRFLHNCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYL
Ga0268330_102059023300028056PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFNICSSICGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0268332_102953913300028058PhyllosphereMLHYSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCRASQLNTPLFDICSSICSNQWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0268342_101919213300028062PhyllosphereTFQDLIDGEYTIAAVSFRAILNQVMDTLGLTCMGGEPYFTRDFKFQAKLSFCRASQPNTPLFDICSSICGRYWEAEESALVRALVYFDEVLG
Ga0268342_102044823300028062PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKISFCRASQPNNKLFDICSSIRGRHWEVEESALVRALVYFDEVLGWTIGDLNYLIYLRLRAFQ
Ga0268326_100054733300028141PhyllosphereMLHYSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESVLVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0268303_10715013300028147PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFCRASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLGXTIGDRNYLIYLQ
Ga0268336_101034713300028152PhyllosphereLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCRASQLNTPFFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLWM
Ga0268312_101285923300028248PhyllosphereLLTLVILHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPCFLHNCKFQAKLSFCRASQLNTPFFDICSSIYSNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0268316_101020213300028253PhyllosphereHQYTIASVSFWAILNQVVDTLGLTWMGGDPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIRDRNYLIYLRLRAMQ
Ga0268310_101214123300028262PhyllosphereMSLLTLVMLHCSFNFHIVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQVKLSFCTASQPNTLLFDICSSICGNEWEAEESALVRALAYFDEVLG
Ga0268310_104717013300028262PhyllosphereMLHCSFNFHNVIITFQDVINGEFTIATVSFRAILNQVMDNFSLTYMGGEPYFTRDLRFQSKLSFCRTCQHNTPLFYICSSICGRHWEAEESALVRALVYFDEVLGWTIRDLNYFRYLQLRAFQ
Ga0268333_101261613300028467PhyllosphereMLYYSFNFHNVIITFQDLIDGEYTIATISFRAILNQVMDNLGLTYIGGEPNFTRDLRFQAKLSFCRASQPNNQLFDICSSIRGRHWEVEESALVRALVYFDEVLGWTIGDLNYLIYLRLRAFQ
Ga0268317_100709513300028468PhyllosphereMLNCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTWMGGDPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLG
Ga0268317_100826913300028468PhyllosphereMLHYFFNFHNVIITFQDLIDGESTIAAVSFRAILNQVMDYLGLIYMGKEPFFTRDFRFQAKLSFCRTCQLNTPLFDICSSICGRYWEAEENALVRALVYFDEVLGWTIGDLNYLRYLQLRAFQ
Ga0268307_100341623300028470PhyllosphereMSLLTLVMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVMDTLGLTCMGGEPYFTRGCRFQAKLSFCRARQLNTPLFDICSSIYNNEWKAEESALVRALTYFDEVLGWTIGDRNYLIYLRMRATQ
Ga0268331_101596513300028474PhyllosphereMLHYSFNFHNTIITFQLIDGEYTIAAVSFRAILNQIIDTLGLICMGGEPYFTRDCRFQAKLSFCRASQPNTPLFDICSSVCGSHWEAEESALVRALVYFDEVLGWTIEDHNYLIYLRMRAML
Ga0268327_101526613300028475PhyllosphereVITTFLQDLIDHQYTIASVSFRAILNQVMDTLGLTWMGGDPHFTRSCRFQAKLSFCRASQPNTPLFDICSSICGNEWEAEESALVRALAYFDEVLGWTIGDHNYLIYLRMRAMQ
Ga0268329_101074513300028476PhyllosphereMSLLTLVMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTWMGGEPHFTRSCRFQAKLSFCRASQPNTPLFDICSSVCGNEWEAEESALVRALAYFDEVLGWTIGDRNYLIYLWMRAMQ
Ga0214493_107823513300032465Switchgrass PhyllosphereYTIASVSFRTILNQVMDTLGLTCMGGEPYFTRSCRFQAKLSFCRASQPNTPLFDICSSIYGHEWEVEESALVHALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0214495_111773313300032490Switchgrass PhyllosphereMLHYSFNFHNIIITFLQDLVDNQYTIASVSFRTILNQVMETLGLTCLGQELYFTRGLRFQAKLSFCRASQPNTPLFDICSSLCGHQWEAEESALVRALVYFDEVLGWTIGDHNYLIYLRMRAMQ
Ga0214490_113158213300032502Switchgrass PhyllosphereMLHCSFNFHNVIITFLQDLIDHQYTIASVSFRAILNQVVDTLGLTCMGGEPHFTRSCRFQAKLSFCRASQSNTLLFDICSSVCGNEWEAEESALVRALAYFDEVLGWTI
Ga0321339_108438523300032551Switchgrass PhyllosphereYSFNFHNIIITFLQDLVDNQYTIASASFRTILNQVMETLGLTCMGEELYFTRGLRFQAKLSFCRASQPNTPLFDICSSLCGHQWEAEESALVRALVYFDEVLGWTIGDHNYLIYLRMRAM
Ga0214501_118944313300032625Switchgrass PhyllosphereMLHYSFNFHNIIITFLQDLVDNQYTIASASFRTILNQVMETLGLTCMGEELYFTRGLRFQAKLSFCRASQPNTPLFDICSSLCGHQWEAEESALVRALVYFDEVLGWTIGDHNYLIYLRMRAMQ
Ga0214497_101591513300032689Switchgrass PhyllosphereMLHYSFNFHNIIITFLQDLVDNQYTIASVSFRTILNQVMETLGLTCLGEELYFTRGLRFQAKLSFCRASQPNTPLFDICSSLCGHQWEAEESALVRALVYFDEVLGWTIGDHNYLIYLRMRAMQ
Ga0314733_110944023300032761Switchgrass PhyllosphereLHCSFNFHNAIITFLQDLIDHQYTIASVSFRTILNQVVDTLGLSCMGGEPYFTRSCRFQAKLSFCRASQPNTPLFDICSSICGHEWEVEESALVHALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0314748_108536613300032791Switchgrass PhyllosphereCSFNLHNAIITFLQDLIDHQYTIASVSFRTILNQVVDTLGLTCMGGEPYFTRSCRFQAKLSFCRASQPNTPLFDICSSIYGHEWEVEESALVHALAYFDEVLGWTIGDRNYLIYLRMRAM
Ga0314749_108965513300032915Switchgrass PhyllosphereMLHCSFNFHNAIITFLQDLIDHQYTIASVNFRTIPNQVVDTLGLTCMGGEPYFTRSCRFQAKLSFCRASQPNTPLFDICSSIYGHEWEVEESALVHALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0314768_125241913300033523Switchgrass PhyllosphereMLHCSFNFHNAIITFLQDLIDHEYTIASVSFWTILNQVMDTLGLTCMGGEPYFTRSCRFQAKLSFCRASQPNTPLFDICSSICGHEWEVEESALVHALAYFDEVLGWTIGDRNYLIYLRMRAMQ
Ga0314762_106442413300033539Switchgrass PhyllosphereDLLDGTITTIAAARFWAILDQVLEKLDLNYMGGESFFNRDLKFQAKLLFYGANQLNTPLFDIYSSICGHYWEGEESALVHALAYFADVLGWTIGDLNYI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.