NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070917

Metagenome / Metatranscriptome Family F070917

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070917
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 153 residues
Representative Sequence MRSSYDSYHNSSSTSSALRNPRYTSPSNYLDLNPTIGGSDRAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Number of Associated Samples 80
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.52 %
% of genes near scaffold ends (potentially truncated) 62.30 %
% of genes from short scaffolds (< 2000 bps) 97.54 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.541 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(69.672 % of family members)
Environment Ontology (ENVO) Unclassified
(50.820 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(81.967 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.73%    β-sheet: 0.00%    Coil/Unstructured: 41.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF03465eRF1_3 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.54 %
UnclassifiedrootN/A2.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002341|JGI24213J29975_1006345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria783Open in IMG/M
3300002343|JGI24214J29971_1004985All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria773Open in IMG/M
3300002344|JGI24217J29970_1007414All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea774Open in IMG/M
3300004259|Ga0058868_1455970All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea879Open in IMG/M
3300007244|Ga0075167_10897055All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1839Open in IMG/M
3300010185|Ga0127504_1077892All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea699Open in IMG/M
3300010198|Ga0127509_1107357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea867Open in IMG/M
3300010199|Ga0127508_1347707All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1802Open in IMG/M
3300010200|Ga0127507_1244012All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea835Open in IMG/M
3300010870|Ga0102750_10249301All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria896Open in IMG/M
3300010870|Ga0102750_11068615All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea826Open in IMG/M
3300010870|Ga0102750_11123674All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea737Open in IMG/M
3300010872|Ga0136897_10019806All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea741Open in IMG/M
3300010874|Ga0136264_10081869All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea935Open in IMG/M
3300010874|Ga0136264_10093959All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea892Open in IMG/M
3300012212|Ga0150985_112433714All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1605Open in IMG/M
3300012469|Ga0150984_120074930All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1604Open in IMG/M
3300019268|Ga0181514_1013366All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1556Open in IMG/M
3300019270|Ga0181512_1634357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea531Open in IMG/M
3300028554|Ga0302047_10019474All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea826Open in IMG/M
3300028554|Ga0302047_10154130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea737Open in IMG/M
3300028554|Ga0302047_10721094All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria896Open in IMG/M
3300030525|Ga0210273_1183267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea789Open in IMG/M
3300030528|Ga0210277_10407256All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1756Open in IMG/M
3300030528|Ga0210277_10407815All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1505Open in IMG/M
3300030528|Ga0210277_10966260All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea775Open in IMG/M
3300030529|Ga0210284_1370350All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea641Open in IMG/M
3300030529|Ga0210284_1820933All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1863Open in IMG/M
3300030531|Ga0210274_1212980All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea569Open in IMG/M
3300030539|Ga0210281_1394491All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1564Open in IMG/M
3300030568|Ga0257206_1021046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea995Open in IMG/M
3300030572|Ga0210258_10277417All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea607Open in IMG/M
3300030572|Ga0210258_10603250All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1758Open in IMG/M
3300030573|Ga0210272_1078151All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1756Open in IMG/M
3300030573|Ga0210272_1124707All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea673Open in IMG/M
3300030575|Ga0210288_1065953All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1790Open in IMG/M
3300030575|Ga0210288_1198047All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1564Open in IMG/M
3300030579|Ga0247633_10048022All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea816Open in IMG/M
3300030581|Ga0210270_1290699All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1830Open in IMG/M
3300030581|Ga0210270_1811112All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea719Open in IMG/M
3300030582|Ga0210261_1028454All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea922Open in IMG/M
3300030582|Ga0210261_1126318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1617Open in IMG/M
3300030586|Ga0265393_1181332All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria544Open in IMG/M
3300030589|Ga0210255_10298136All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1512Open in IMG/M
3300030589|Ga0210255_10442544All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea549Open in IMG/M
3300030589|Ga0210255_10752497All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea926Open in IMG/M
3300030589|Ga0210255_10859792All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea785Open in IMG/M
3300030593|Ga0210263_1031338All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1891Open in IMG/M
3300030593|Ga0210263_1124161All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea611Open in IMG/M
3300030594|Ga0210280_1106262All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea616Open in IMG/M
3300030595|Ga0210276_10439128All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1519Open in IMG/M
3300030596|Ga0210278_1126098All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea605Open in IMG/M
3300030598|Ga0210287_1073267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1769Open in IMG/M
3300030602|Ga0210254_10510028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea838Open in IMG/M
3300030603|Ga0210253_10285697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea684Open in IMG/M
3300030603|Ga0210253_11044470All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1508Open in IMG/M
3300030605|Ga0210265_1045549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea750Open in IMG/M
3300030605|Ga0210265_1137304All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1547Open in IMG/M
3300030611|Ga0257182_1084397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea889Open in IMG/M
3300030612|Ga0257196_1118523All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea863Open in IMG/M
3300030622|Ga0265391_10253756All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1564Open in IMG/M
3300030626|Ga0210291_11125562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1527Open in IMG/M
3300030626|Ga0210291_11125616All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea798Open in IMG/M
3300030626|Ga0210291_11781365All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1615Open in IMG/M
3300030630|Ga0210282_10121737All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1743Open in IMG/M
3300030631|Ga0210279_10129963All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1812Open in IMG/M
3300030631|Ga0210279_10238835All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea668Open in IMG/M
3300030632|Ga0210250_10788335All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1925Open in IMG/M
3300030632|Ga0210250_11405057All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea923Open in IMG/M
3300030632|Ga0210250_11882155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1675Open in IMG/M
3300030738|Ga0265462_10877284All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1748Open in IMG/M
3300030738|Ga0265462_10987511All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1721Open in IMG/M
3300030740|Ga0265460_10740039All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea846Open in IMG/M
3300030740|Ga0265460_12460716All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1553Open in IMG/M
3300030741|Ga0265459_11531854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea764Open in IMG/M
3300030741|Ga0265459_11591513All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1754Open in IMG/M
3300030743|Ga0265461_10882920All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea857Open in IMG/M
3300030748|Ga0074043_11559689All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea791Open in IMG/M
3300030755|Ga0074023_1096105All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea640Open in IMG/M
3300030774|Ga0074007_11091466All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea786Open in IMG/M
3300030782|Ga0102754_1835308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea830Open in IMG/M
3300030784|Ga0102758_10961608All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1772Open in IMG/M
3300030909|Ga0074033_10877218All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea665Open in IMG/M
3300030911|Ga0102763_11193757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea790Open in IMG/M
3300030922|Ga0138300_1433914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1698Open in IMG/M
3300030933|Ga0074039_11634498All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea844Open in IMG/M
3300030949|Ga0074031_1962216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea843Open in IMG/M
3300030959|Ga0102747_11264179All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1581Open in IMG/M
3300030980|Ga0074027_10065966All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1284Open in IMG/M
3300030980|Ga0074027_11397257All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea754Open in IMG/M
3300030992|Ga0074040_11332453All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea759Open in IMG/M
3300031008|Ga0074038_10021509All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1704Open in IMG/M
3300031008|Ga0074038_11999910All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea958Open in IMG/M
3300031031|Ga0074042_10025908All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea893Open in IMG/M
3300031034|Ga0074041_10002189All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea751Open in IMG/M
3300031034|Ga0074041_10060824All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea763Open in IMG/M
3300031035|Ga0074026_10041377All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea754Open in IMG/M
3300031035|Ga0074026_11314601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1792Open in IMG/M
3300031057|Ga0170834_105133620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1933Open in IMG/M
3300031128|Ga0170823_11650208All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1560Open in IMG/M
3300031128|Ga0170823_14837392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1815Open in IMG/M
3300031231|Ga0170824_123636018All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1933Open in IMG/M
3300031231|Ga0170824_125753908All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea681Open in IMG/M
3300031411|Ga0102761_10294179All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → Rotaria socialis955Open in IMG/M
3300031446|Ga0170820_14882342All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1840Open in IMG/M
3300031474|Ga0170818_103155983All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1672Open in IMG/M
3300031474|Ga0170818_109346392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1514Open in IMG/M
3300031474|Ga0170818_110858708All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea821Open in IMG/M
3300032470|Ga0314670_10236393All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1932Open in IMG/M
3300032514|Ga0214502_1152236All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea888Open in IMG/M
3300032593|Ga0321338_1177441All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea764Open in IMG/M
3300032739|Ga0315741_10591663All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea929Open in IMG/M
3300032739|Ga0315741_10831888All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea809Open in IMG/M
3300032756|Ga0315742_10330726All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood11138Open in IMG/M
3300032756|Ga0315742_10649859All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Philodinida → Philodinidae → Didymodactylos → Didymodactylos carnosus945Open in IMG/M
3300032756|Ga0315742_10679454All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea932Open in IMG/M
3300032756|Ga0315742_11170200All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1785Open in IMG/M
3300032756|Ga0315742_12486299All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1590Open in IMG/M
3300033543|Ga0314765_1298385All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1501Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil69.67%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil13.93%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated3.28%
Wastewater TreatmentEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment3.28%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.46%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere2.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.64%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.82%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002341Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - D_52min_Anaerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300002343Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - F_92min_Anaerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300002344Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI - N_134min_Aerobic (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300004259Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time F- 52min-Aerobic_ RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300007244Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300010185Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fa - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010198Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010199Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010200Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010870Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010872Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5)EnvironmentalOpen in IMG/M
3300010874Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028554Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)EnvironmentalOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030568Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030611Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030612Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030755Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030774Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030782Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030784Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030911Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030922Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030992Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033543Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24213J29975_100634513300002341Wastewater TreatmentALLPFSLHRYRTTSREKKKKRSTRRKMRSIHDSFHHSTNSSHYTSPASGSERAEFHDRYQNRYAWLEKNHVTEVGSTYKSLGKQVDHKPSTWRCEDQAAAGKEFLRANDECADKIYDIRERSDVSRECLLNADGVAPRFYQMEAEALKNRYELNNMKRKLDGIKQMRARLFK*
JGI24214J29971_100498513300002343Wastewater TreatmentMRSIHDSFHHSTNSSHYTSPASGSERAEFHDRYQNRYAWLEKNHVTEVGSTYKSLGKQVDHKPSTWRCEDQAAAGKEFLRANDECADKIYDIRERSDVSRECLLNADGVAPRFYQMEAEALKNRYELNNMKRKLDGIKQMRARLFK*
JGI24217J29970_100741413300002344Wastewater TreatmentRETSTFVRDVDALLPFSLHRYRTTSREKKEKRSTRRKMRSIHDSFHHSTNSSHYTSPASGSERAEFHDRYQNRYAWLEKNHVTEVGSTYKSLGKQVDHKPSTWRCEDQAAAGKEFLRANDECADKIYDIRERSDVSRECLLNADGVAPRFYQMEAEALKNRYELNNMKRKLDGIKQMRARLFK*
Ga0058868_145597023300004259Wastewater TreatmentMHSTLDTYRSSSTVRNTRLHSPSPYLDLGSSGSGSDRAEFRDRYQNRYAWLEKNHVTEVGSQYNSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSREWLLNSDGVAPRFYQMEADSLKTRYELNNMKRKLDGIKQLRARLFK*
Ga0075167_1089705523300007244Wastewater EffluentMRSSYDSYYSSSASLRNSNHSSPLHSLDAALTPFSGSDRAEFRDRYENKYAWLEKNHVNQVGSTYKSLGKQVDHKPSTWRCEDQAETGKEFLRINDECADKIYDIRERSDLFREWLLNADGVAPRFYRLEADALKTRYELNNIKRKLEGIKQLRARLFK*
Ga0127504_107789213300010185Host-AssociatedMRSSYDSYHTSSSTSNALRNPRYTSPSNYLDLNPTTGGSERAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0127509_110735713300010198Host-AssociatedMHSAFDSYRSSSTAKSAPHYKSPSNYLDLNGAAGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKSLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDISREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0127508_134770713300010199Host-AssociatedMHSTYDTYHSSSNSLRNSNYSSPLHSLDAGLTPFSGSDRAEFHDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQTEAGKEFLRINDECADKIYDIRERSDLSRESLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0127507_124401213300010200Host-AssociatedMRSSYDSYHTSSSTSSALRNPRYQTPSNYLDLNPTIGGSERAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQLRARLFK*
Ga0102750_1024930123300010870SoilLSHHSSPSHLLDSHTGPSGGSERSEFRDRYGNRYAWLEKNHVTEVGSTYNTIGKKVDHKPSTWRCEDQALAGKEFLRLNDECADKIYDIRDRSDMSREWLLNSDGVAPRFYQMEADAMKNRYELNNMKRKLDSIKQMRTRLLK*
Ga0102750_1106861513300010870SoilMRSSHDSYRSSSTLNSSRYRSPSNYLDLNSPAGGSERAEFRDRYQNRYAWLEKNHVTEVGSTYNTLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKARYELNNMKRKLDGIKQLRARLFK*
Ga0102750_1112367413300010870SoilSHDSYHHSSSTLNNTRYRSPSNFLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0136897_1001980613300010872SoilSSHDSYHHSSSTLNNTRYRSPSNFLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0136264_1008186923300010874SoilLDSHTGPSGGSERSEFRDRYGNRYAWLEKNHVTEVGSTYNTIGKKVDHKPSTWRCEDQALAGKEFLRLNDECADKIYDIRDRSDMSREWLLNSDGVAPRFYQMEADAMKNRYELNNMKRKLDSIKQMRTRLLK*
Ga0136264_1009395923300010874SoilMRSSHDSYRSSSTLNSSRYRSPSNYLDLNSPAGGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0150985_11243371413300012212Avena Fatua RhizosphereDSYHHSSSSLLNSHHTSPVHHLDLNSSNAGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKSLGKAVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0150984_12007493013300012469Avena Fatua RhizosphereMRSSHDSYHHSSSSLLNSHHTSPVHHLDLNSSNAGSERAEFHDRYQNRYAWLEKAHVNEVGSQYNTIGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK*
Ga0181514_101336613300019268PeatlandMRSTYDSYASTSLRNSNYSSPSHSLDISLTPFSGSERAEFQDRYQNKYAWLEKNHVNEVGSTYKSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSREWLLNSDGVAPRFYQLEADALKSRYELNNMKRKLDGIK
Ga0181512_163435713300019270PeatlandHNSYHHSSSTSNSLSNPRYTAPSNYLDLNSSAGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYNTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDISREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0302047_1001947413300028554SoilMRSSHDSYRSSSTLNSSRYRSPSNYLDLNSPAGGSERAEFRDRYQNRYAWLEKNHVTEVGSTYNTLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKARYELNNMKRKLDGIKQLRARLFK
Ga0302047_1015413013300028554SoilSHDSYHHSSSTLNNTRYRSPSNFLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0302047_1072109423300028554SoilLSHHSSPSHLLDSHTGPSGGSERSEFRDRYGNRYAWLEKNHVTEVGSTYNTIGKKVDHKPSTWRCEDQALAGKEFLRLNDECADKIYDIRDRSDMSREWLLNSDGVAPRFYQMEADAMKNRYELNNMKRKLDSIKQMRTRLLK
Ga0210273_118326713300030525SoilRNSRHHTPSTYLDLAPTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDFSRECLLNSDGVAARFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210277_1040725613300030528SoilMRSSTYDSYHHSSSSSNALNSHHRSPASYLDLHPSTGSDRQEFHDRYQNRYAWLEKNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRECLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLLK
Ga0210277_1040781513300030528SoilYDSYSSSSNSLRNSHYSSPSHSLDIGITPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGQKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDLSRESLLNSDGVASRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210277_1096626013300030528SoilTSLFSRNRTPSHYSDLATPSGGSERAEFHDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDFSRECLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210284_137035013300030529SoilRYQSTSNYLDLNPTTSGSERAEFHDRYQNRYAWLEKNHVNEVGSQYNTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDLSRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210284_182093323300030529SoilMRSSYDSHYSSTNSLRNSHYSSPSHSLDIGLTPFTGSDRAEFRDRYQNKYAWLEKNHVNAVGSTYKSLGKQVDHKPSTWRCEDQAETGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210274_121298013300030531SoilMRSSHDSYHHSSSTLNNTRYRSPSNFLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISREHLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210281_139449113300030539SoilLSPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDLSRESLLNSDGVASRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0257206_102104623300030568Host-AssociatedMRSSHDSYHHTSSTSSSLNNPRYRSPSNYLDLNPTTSGSDRAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERTDISRESLLNSDGVATRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210258_1027741713300030572SoilMHSSYDSYHGSSSTSSSLRNSRHHTPSNYLDLNPTTAGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDFSRECLLNSDGVASRFYKMEADALKTRYELNNMKRKLEGIKQLRARLFK
Ga0210258_1060325013300030572SoilMRSTYDSHYSSSNSLRNSNYSSPSHSLDIGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210272_107815113300030573SoilMRSSTYDSYHHSSSSSNALNSHHRSPASYLDLHPSTGSDRQEFHDRYQNRYAWLEKNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRECLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0210272_112470723300030573SoilSSYDSHHLSSSTSSSLRNPRYTSPSNYLDLNPTTGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSAWRCEDQAEAGKEFLRLNDECADKIYDIRERSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210288_106595313300030575SoilLRNSSHSSPLHSLDIGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210288_119804713300030575SoilMRSTYDSYSSSNSLRNSSHSSPLHSLDIGLTPFTGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDLSRESLLNSDGVASRFYQMEADALKKSL
Ga0247633_1004802213300030579SoilSSYDSYQSTSTASSALRGPRYQSPSNYLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNDVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRFNDECADKIYDIRERSDLSRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210270_129069913300030581SoilRSTYDLHSSSSNSLRNSHYSSPSHSPDIGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGQKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDLSRESLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210270_181111213300030581SoilMRSSHDSYHHSSASSRYVPPSNYLDLGSSGVGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRECLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0210261_102845413300030582SoilYDSHHHSSSSSHHSPRYTPSSNYLDLSTTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210261_112631813300030582SoilMRSSYDSHYSSSNSLRNSHYSSPSHSLDIGLTSLGGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDFSRECLLNSDGVATRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210262_111321013300030583SoilGGSDRAEFHDRYQNRYPWLEKTHVNEVGSTYKSLGKKVDHKPSTWRCEDQAETGKELLRINDECADKIYDIRERSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0265393_118133213300030586SoilLNSHHRSPASYLDLHPSTGSDRQEFHDRYQNRYAWLEKNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRECLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0210255_1029813613300030589SoilHYRSLSTATSLHNAHYGTPSSYLDLTPSGGASERAEFHDRYQNRYAWLEQNHVNDVGSDYKTIGKKVDHKPATWRCEDQTEAGKEFLRINDECADKIYDIRERSDISREALLNSDGVAPRFYQMEADAIKTRYELNNMKRKLDGNKQLRARLFK
Ga0210255_1044254413300030589SoilSSGGGGSDRAEFRDRYDTRYAWLEKNHVNEVGSTYKTIGKQVDHKPSTWRCEDQAAAGKEFLRINDECADKIYDIRDRSDMNREFLLNADGVAPRFYQMEADALKNRYELNNMKRKLDGIKQMRARLFK
Ga0210255_1075249713300030589SoilMRSSYDSHHHSSSSSHHSPRYTPSSNYLDLSTTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210255_1085979213300030589SoilRYTSPSNYLDLNPTTGGSDRAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRLNDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210263_103133813300030593SoilHHSSSSSNALNSHHRSPASYLDLHPSTGSDRQEFHDRYQNRYAWLEKNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRECLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0210263_112416113300030593SoilYDSYHSTTASTSSNVRSPRYQSPSTFSDFNPSIGGSERAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFYKMEADALKTRYELNNMKRKLEGIKQLRARLFK
Ga0210280_110626223300030594SoilRYTPSSNYLDLSTTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRECLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210276_1043912813300030595SoilMRSSYDSYHSSSSSLRNSNYSSPHSLDIGLTPFSGSDRAQFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRMNDECADKIYDIRERSDISRESLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDG
Ga0210278_112609823300030596SoilSHHSSSSTSNSLRNSRHHTPATDLDLAPTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDYSRECLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210287_107326713300030598SoilSPSHSLNAGITPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFQRMNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210254_1051002813300030602SoilHNNTMHSSYDSHHSSSSTSNSLRNSRHHTPSTYLDLAPTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210253_1028569713300030603SoilHNAHYGTPSSYLDLTPSGGASERAEFHDRYQNRYAWLEQNHVNDVGSDYKTIGKKVDHKPATWRCEDQTEAGKEFLRINDECADKIYDIRERSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210253_1104447013300030603SoilRNSSNYSSPSHSWDTGLAPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDISRESLLNSDGVAPRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210265_104554923300030605SoilRSSYDSHHHSSSSSHHSPRYTPSSNYLDLSTTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210265_113730413300030605SoilMRSTYDLHSSSSNSLRNSHYSSPSHSPDIGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGQKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDLSRESLLNSDGVAPRFYQLEADALKNRYELNNMKRKLDGIKQLRARLF
Ga0257182_108439713300030611Host-AssociatedMRSSYDSYHTSSSTSSALRNPRYQTPSNYLDLNPTTGGSERAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWICEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0257196_111852313300030612Host-AssociatedYHNKTMHTSHDSYNRSSSTSSALRNSRYQSPSNYLDLNPTTSGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTLGKQVDHKPSTWRCEDQAEAGKEFQRINDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKARYELNNMKRKLDGIKQLRARLFK
Ga0265391_1025375613300030622SoilMRSTYDLHSSSSNSLRNSHYSSPSHSPDIGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIWDIRERSDISRESLLNSDGVATRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210291_1112556213300030626SoilSTYDLHSSSSNSLRNSHYSSQSHSPDIGLTPFSGSDRAEFRDPYQNKYAWLEKNHVNEVGSTYNSLGQKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDLSRESLLNSDGVASRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210291_1112561613300030626SoilSSTSSSLRNPRYTSSSNYLDLNPTTGGSDRAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRLNDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLEGIKQLRARLFK
Ga0210291_1178136513300030626SoilSNSLRNSHYSSPSHSPDIGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDVSRESLLNSDGVAPRFYQLEADALKNRYELNNMKRKLEGIKQLRARLFK
Ga0210282_1012173723300030630SoilYSSPSHSLDSFGGGGGSDRAEFHDRYQNRYPWLEKTHVNEVGSTYKSLGKKVDHKPSTWRCEDQTEAGKEFLKINDECADKIYDIRERSDISRESLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210279_1012996323300030631SoilMRSTYDSYSSSNSLRNSSHSSPLHSLDIGLTPFTGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYRTLGKQVDHKPSTWRCEDQTEAGKEFLKINDECADKIYDIRERSDISREWLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210279_1023883523300030631SoilSSYDSYHGSSSTSSSLRNSRHHTPSNYLDLNPITAGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKARYELNNMKRKLDGIKQLRARLFK
Ga0210250_1078833513300030632SoilMRSTYDSYSSSSNSLRNSHYSSPSHSLDIGITPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDLSRESLLNSDGVAPRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210250_1140505713300030632SoilMHSSYDSYHGSSSTSSSLRNSRHHTPSNYLDLNPTTAGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTIGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDFSRECLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0210250_1188215513300030632SoilMRSSYDSYHSSSSSLRNSNYSSPHSLDIGLTPFSGSDRAQFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRMNDECADKIYDIRERSDISRESLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0265462_1077904413300030738SoilGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKSLGKQVDHKPSTWKCEDQAEAGKEFLRLNDECADKIYDIRERSDMSREWLLNSDGVAPRFYQMEAEALKNRYELNNMKRKLDGIKQLRARLFK
Ga0265462_1087728413300030738SoilMRSTYDSYSSSNSLRNSSHSSPLHSLDIGLTPFTGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNTLGKRVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0265462_1098751113300030738SoilMRSSYDSHYSSTNSLRNSHYSSPSHSLDIGLTPFTGSDRAEFHDRYQNKYAWLEKNHVNEVGSQYKSLGKKVDHKPSTWRCEDQAETGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQLEADALKNRYELNNMKRKLEGIKQMRARLFK
Ga0265460_1074003913300030740SoilSSYDSHHHSSSSSHHSPRYTPSSNYLDLSTTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDYSRECLLKSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0265460_1246071613300030740SoilMRSTYDSYSSSNSLRNSSHSSPLHSLDIGLTPFTGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYRTLGKQVDHKPSTWRCEDQTEAGKEFLKINDECADKIYDIRERSDISREWLLNSDGVAPRFYQMEADALKNRYELNNMKRKLDGIKQ
Ga0265459_1153185423300030741SoilMRSSYDSHHLSSSTSSSLRNPRYTSPSNYLDLNPTTGGSDRAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRLNDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0265459_1159151323300030741SoilMRSSHDSHYRSLSTATSLHNAHYGTPSSYLDLTPSGGASERAEFHDRYQNRYAWLEQNHVNDVGSDYKTIGKKVDHKPATWRCEDQTEAGKEFLRINDECADKIYDIRERSDISREALLNSDGVAPRFYQMEADAIKTRYELNNMKRKLDGIKQLRARLFK
Ga0265461_1088292013300030743SoilMRSSYDSYRHSSLAQSNDRTYRHTTPSTYLDLGSSIGGSDRAEFRDRYLTRYPWLEKTHVTEVGSTYKNIGKKVDHKPSAWRCEDQAEAGKEFLRLNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074043_1155968913300030748SoilTPHHHHSTSNYLDLNPTTGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRESSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074023_109610523300030755SoilMRSSYDSYQSTTASSTVRSPRYQSPSTFLDLNPSIGGSERAEFRDRYLNRYPWLEKTHVTEVGSTYNNLGKKVDHKPSTWRCEDQAEAGKEFQRLNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNKYELNNMKRKLDGIKQLRARLFK
Ga0074007_1109146613300030774SoilRYRSPSNFLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKARYELNNMKRKLDGIKQLRARLFK
Ga0102754_183530813300030782SoilMRSSHDSYHHSSSALNTTRYRSPSNFLDLNPTTSGSERAEFRDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKARYELNNMKRKLDGIKQLRARLFK
Ga0102758_1096160813300030784SoilMRSTYESSHYSSSTSNSLRDPLRSARAHSVDVSLLPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRECLLNSDGVAPRFYQMEADALKTRYDLNNMKRKLEGIKQLRARLFK
Ga0074033_1087721813300030909SoilSSSTANTTRYRSPSNYLDLNPATGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTLGKKVDHKPSTWRCEDQADAGKELLRMNDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0102763_1119375713300030911SoilTLNSSRYRSPSNYLDLNSPAGGSERAEFRDRYQNRYAWLEKNHVTEVGSTYNTLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0138300_143391413300030922SoilSPSHLDIGLSPLHGRDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDVSRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLEGIKQLRARLFK
Ga0074039_1163449823300030933SoilLSKMHSSHDSYRSSSTAPSSHRTPHHHHSTSNYLDLNPTTGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074031_196221613300030949SoilSSYDSHHHSSSSSHHSPRYTPSSNYLDLSTTAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0102747_1126417913300030959SoilFSRNRPSSHHYTDLASSHGGSERAEFHDRYQNRYAWLESNHVNDVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSRESLLNSDGVAPRFYQMEAEALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074027_1006596623300030980SoilLTTIVCRRGSKRSDPCNLDLNSAAGGSERAEFHDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSREWLLNSDGVASRFYQMEADALKKSL
Ga0074027_1139725713300030980SoilSHHSPRYTSPASYLDLSSSAGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074040_1133245313300030992SoilFSRNRAPSHYSDLASSAGGSERAEFHDRYQNRYAWLEKNHVTDVGSQYKSLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDYSRECLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074038_1002150913300031008SoilSSYDSHHSSSSTANSLRNTRYQSPSLYSDLAPTAGASDRQEFHDRYQNRYAWLEKNHVTEVGSQYKNIGKKVDHKPSTWKCEDQAEAGREFLRINDECADKIYDIRERSDISRESLLSSDGVATRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074038_1199991013300031008SoilAVRDSSCPSTNRWRTRRSASRSPYRSSSTAPSSHRTPHHHHSTSNYLDLNPTTGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRESSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074042_1002590813300031031SoilMHSSHSSYRSASAAPTSYRTPHYQSPSNYLDLNAATGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRESSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074041_1000218923300031034SoilMRSSYDSYHNSSSTSSALRNPRYTSPSNYLDLNPTIGGSDRAEFRDRYQNRYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074041_1006082413300031034SoilSNYLDLNPTTGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRESSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074026_1004137723300031035SoilHSSHSSYRSASAAPTSYRTPHYQSPSNYLDLNAATGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0074026_1131460113300031035SoilYSSSTSNSLRNSNYSSPSHSLDIGLTPFTGSDRAEFHDRYQNKYAWLEKNHVNEVGSQYKSLGKKVDHKPSTWRCEDQVEAGKEFLRINDECADKIFDIRERSDVSRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQMRARLFK
Ga0170834_10513362013300031057Forest SoilMRSSTYDSYHHSSSSSNALNSHHRSPASYLDLHPSTGSDRAEFHDRYQNRYAWLEKNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0170823_1165020813300031128Forest SoilKKMRSSHDSYHHSSSTSNSLNSHHRSPASYLDLHPSTGSDRAEFHDRYQNRYAWLEKNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0170823_1483739213300031128Forest SoilSTSNSLRNSNYSSPSHSLDIGITPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0170824_12363601813300031231Forest SoilMRSSTYDSYHHSSSSSNALNSHHRSPASYLDLHPSTGSDRAEFHDRYQNRYAWLEQNHVNDVGSTYNNIGKKVDHKPSAWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVAPRFYQMEADALKTRYELNNMKRKLDGIKQMRARLFK
Ga0170824_12575390813300031231Forest SoilTSSALRNSRHQTPSNYLDLHPTTGGSERAEFRDRYQNRYAWLEKNHVNEVGSQYNTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0102761_1029417923300031411SoilMRSSHDSYHHSSSASRYRSPSHFSDSTPLTGGSDRAEFRDRYQNRYAWLEKNHVTEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMSREWLLNSDGVAPRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0170820_1488234223300031446Forest SoilMRSSSYDTYYSSSTRNSNYSSPLHSLDAGLTPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDISRESLLNSDGVASRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0170818_10315598323300031474Forest SoilSTSNSLRNSNYSSPSHSLDIGITPFSGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIRERSDISRESLLNSDGVASRFYQLEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0170818_10934639213300031474Forest SoilYTNKMRSAYGSHSSSSHLRNSHYSSPSHSLDITPFIGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYKTLGKQVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDISRESLLNSDGVASRFLSIRS
Ga0170818_11085870813300031474Forest SoilSSSTSNSLRNSRYQSPSNYLDLTPAAGASDRAEFRDRYQNRYAWLEKNHVNEVGSQYNTLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIFDIRERSDLSRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0314670_1023639313300032470SeawaterLNNNVYTISVEIIVRQSEEKMHSSYDSYRSSSVAPSSRRTPHYQASSNYLDLVPTAGGSDRAEFHDRYQNRYAWLEKNHVNEVGSQYKSLGKQVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDISREWLLNSDGVAPRFYQMEADALKTRYELNNMKRKLEGIKQLRARLF
Ga0214502_115223613300032514Switchgrass PhyllosphereRNILIEFSSTMRSSYDPHHYSSSSLSSGLNRNYRHATPSNYLDLNSAVGGSERAEFHDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMNREFLLNADGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0321338_117744113300032593Switchgrass PhyllosphereKRNILIEFSSTMRSSYDPHHYSSSSLSSGLNRNYRHATPSNYLDLNSAVGGSERAEFHDRYQNRYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIYDIRERSDMNREFLLNADGVAPRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0315741_1059166323300032739Forest SoilMRSSHDSSYHHSTSNTTRYRSPSNYLDLNPIAGGGSDRAEFRDRYQNRYAWLEKNHVNEVGSQYNNLGKKVDHKPSTWRCEDQAEAGKEFLRMNDECADKIFDIRERSDISRESLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0315741_1083188813300032739Forest SoilSSTVRSPRYQSPSTFLDLNPSIGGSERAEFRDRYLNRYPWLEKTHVTEVGSTYNNLGKKVDHKPSTWRCEDQAEAGKEFQRLNDECADKIYDIRERSDISRESLLNSDGVASRFYQMEADALKNKYELNNMKRKLDGIKQLRARLFK
Ga0315742_1033072613300032756Forest SoilNSNYSSPSHSLDTSLSHGSERAEFHDRYQNKYAWLEKNHVNEVGSQYNSLGKKVDHKPSTWRCEDQAEAGREFLRINDECADKIYDIHERSDISRESLLNSDGVAPRFYQMEADALKNRYELNNIKRKLDGIKQMRARLFK
Ga0315742_1052172413300032756Forest SoilSVNYNKTMRSSSLDYHRSSSLHHNNSGPSLHNSTGHDSYKHTSAGASDRQQFKDNYQNRYAWLEKNHVNEVGSTYNRLGKTVGHKPSFWRCEDQAIAGKEFQRLNDECADKIWDIRDKSDMSREWLLDADGVAPRFYQMEADALKNRYELNNMKRKLENIKAMRIRLLK
Ga0315742_1064985913300032756Forest SoilHSHHNSSSGGHHSNLHNSLALDNHTFSSAGASDRQQFKDNYQNRYAWLEKNHVNEVGSTYNRLGKTVGHKPSYWRCEDQAIAGKEFQRLNDECADKIWEIRDKSDMSREWLLDADGVAPRFYKMEADALKNRYELNNMKRKLENLKSMRTRLLK
Ga0315742_1067945413300032756Forest SoilARSHLHVDGLLQLTKRNIFIESLSKMHSSHDSYRSSSTAPSSHRTPHHHHSTSNYLDLNPTTGGSERAEFHDRYQNRYAWLEKNHVNEVGSQYKTLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRESSDLSREWLLNSDGVASRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0315742_1117020023300032756Forest SoilMHSSYDSHHSSSSTANSLRNTRYQSPSLYSDLAPTAGASDRQEFHDRYQNRYAWLEKNHVTEVGSQYKNIGKKVDHKPSTWKCEDQAEAGREFLRINDECADKIYDIRERSDISRESLLSSDGVATRFYQMEADALKNRYELNNMKRKLDGIKQLRARLFK
Ga0315742_1248629923300032756Forest SoilMRSSYDSHYSSSATNRHSNYSSPLHSLDIGLAPFHGSDRAEFRDRYQNKYAWLEKNHVNEVGSTYNSLGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSRESLLNSDGVATRFYQMEADALKNRYELNNMKRKLEGIKQMRARL
Ga0314765_129838513300033543Switchgrass PhyllosphereKMHSSHDTYRSSSTSSALRNSRYRSPSVYLDLAPTAGASDRAEFHDRYQNRYAWLEKNHVNEVGSQYNSIGKKVDHKPSTWRCEDQAEAGKEFLRINDECADKIYDIRERSDLSREWLLNSDGVAPRFYQMEADALKTRYELNNMKRKLEGIKQLRARLFK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.