NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071193

Metagenome Family F071193

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071193
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 44 residues
Representative Sequence MQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG
Number of Associated Samples 59
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 84.43 %
% of genes near scaffold ends (potentially truncated) 27.05 %
% of genes from short scaffolds (< 2000 bps) 81.97 %
Associated GOLD sequencing projects 42
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (64.754 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(78.688 % of family members)
Environment Ontology (ENVO) Unclassified
(95.902 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.164 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.39%    β-sheet: 11.11%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF03237Terminase_6N 3.28
PF06074DUF935 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG4383Mu-like prophage protein gp29Mobilome: prophages, transposons [X] 0.82

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A64.75 %
All OrganismsrootAll Organisms35.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10067605All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300000101|DelMOSum2010_c10205292Not Available657Open in IMG/M
3300000115|DelMOSum2011_c10099297Not Available958Open in IMG/M
3300000117|DelMOWin2010_c10017756All Organisms → Viruses → Predicted Viral3790Open in IMG/M
3300000117|DelMOWin2010_c10248127Not Available522Open in IMG/M
3300006025|Ga0075474_10010259Not Available3590Open in IMG/M
3300006025|Ga0075474_10180795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300006026|Ga0075478_10009630Not Available3303Open in IMG/M
3300006026|Ga0075478_10026988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20111922Open in IMG/M
3300006027|Ga0075462_10082886Not Available1004Open in IMG/M
3300006637|Ga0075461_10017288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20112380Open in IMG/M
3300006752|Ga0098048_1012457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae2968Open in IMG/M
3300006802|Ga0070749_10140033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1412Open in IMG/M
3300006802|Ga0070749_10284681Not Available930Open in IMG/M
3300006810|Ga0070754_10073720All Organisms → Viruses → Predicted Viral1738Open in IMG/M
3300006810|Ga0070754_10077741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20111680Open in IMG/M
3300006810|Ga0070754_10122845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20111263Open in IMG/M
3300006810|Ga0070754_10136221Not Available1185Open in IMG/M
3300006810|Ga0070754_10150187All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300006810|Ga0070754_10183853Not Available982Open in IMG/M
3300006810|Ga0070754_10232731Not Available847Open in IMG/M
3300006810|Ga0070754_10307346All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium710Open in IMG/M
3300006810|Ga0070754_10342085Not Available663Open in IMG/M
3300006810|Ga0070754_10482972Not Available534Open in IMG/M
3300006810|Ga0070754_10516905Not Available513Open in IMG/M
3300006867|Ga0075476_10063786All Organisms → Viruses → Predicted Viral1466Open in IMG/M
3300006867|Ga0075476_10244902Not Available641Open in IMG/M
3300006867|Ga0075476_10293491Not Available571Open in IMG/M
3300006868|Ga0075481_10021692Not Available2531Open in IMG/M
3300006868|Ga0075481_10097414All Organisms → Viruses → Predicted Viral1094Open in IMG/M
3300006868|Ga0075481_10228014Not Available661Open in IMG/M
3300006869|Ga0075477_10444177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300006870|Ga0075479_10288266Not Available645Open in IMG/M
3300006874|Ga0075475_10203476Not Available847Open in IMG/M
3300006874|Ga0075475_10347956Not Available603Open in IMG/M
3300006916|Ga0070750_10131303Not Available1144Open in IMG/M
3300006916|Ga0070750_10199576Not Available886Open in IMG/M
3300006916|Ga0070750_10213166Not Available850Open in IMG/M
3300006916|Ga0070750_10350396Not Available623Open in IMG/M
3300006916|Ga0070750_10452555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300006919|Ga0070746_10096031All Organisms → Viruses → Predicted Viral1483Open in IMG/M
3300006919|Ga0070746_10233249Not Available865Open in IMG/M
3300006919|Ga0070746_10306419Not Available728Open in IMG/M
3300006919|Ga0070746_10377673Not Available638Open in IMG/M
3300006919|Ga0070746_10413460Not Available603Open in IMG/M
3300006922|Ga0098045_1070866Not Available841Open in IMG/M
3300007234|Ga0075460_10059056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1427Open in IMG/M
3300007236|Ga0075463_10133246Not Available802Open in IMG/M
3300007236|Ga0075463_10251915Not Available567Open in IMG/M
3300007344|Ga0070745_1120504Not Available1011Open in IMG/M
3300007344|Ga0070745_1204127Not Available729Open in IMG/M
3300007344|Ga0070745_1214210All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium707Open in IMG/M
3300007344|Ga0070745_1224544Not Available687Open in IMG/M
3300007344|Ga0070745_1296660All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium576Open in IMG/M
3300007346|Ga0070753_1054089All Organisms → Viruses → Predicted Viral1643Open in IMG/M
3300007346|Ga0070753_1112281Not Available1055Open in IMG/M
3300007346|Ga0070753_1143835All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium906Open in IMG/M
3300007346|Ga0070753_1157557Not Available858Open in IMG/M
3300007346|Ga0070753_1175107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011803Open in IMG/M
3300007346|Ga0070753_1204448Not Available730Open in IMG/M
3300007539|Ga0099849_1026217Not Available2513Open in IMG/M
3300007540|Ga0099847_1066535Not Available1119Open in IMG/M
3300007640|Ga0070751_1218602Not Available734Open in IMG/M
3300007640|Ga0070751_1268358Not Available643Open in IMG/M
3300007640|Ga0070751_1291943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300008012|Ga0075480_10139574All Organisms → Viruses → Predicted Viral1325Open in IMG/M
3300008012|Ga0075480_10428648Not Available647Open in IMG/M
3300008012|Ga0075480_10479967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300008012|Ga0075480_10519197Not Available571Open in IMG/M
3300009507|Ga0115572_10202890Not Available1145Open in IMG/M
3300010149|Ga0098049_1096708Not Available925Open in IMG/M
3300010296|Ga0129348_1007379All Organisms → Viruses → Predicted Viral4001Open in IMG/M
3300010297|Ga0129345_1300060Not Available556Open in IMG/M
3300011253|Ga0151671_1024758Not Available647Open in IMG/M
3300017697|Ga0180120_10214190Not Available793Open in IMG/M
3300017763|Ga0181410_1141447Not Available679Open in IMG/M
3300017771|Ga0181425_1238110Not Available565Open in IMG/M
3300019756|Ga0194023_1041584Not Available927Open in IMG/M
3300019756|Ga0194023_1057346Not Available783Open in IMG/M
3300020166|Ga0206128_1097833Not Available1277Open in IMG/M
3300021373|Ga0213865_10216187Not Available938Open in IMG/M
3300021425|Ga0213866_10032089Not Available3054Open in IMG/M
3300022065|Ga0212024_1012520Not Available1292Open in IMG/M
3300022065|Ga0212024_1058820Not Available679Open in IMG/M
3300022071|Ga0212028_1002126Not Available2349Open in IMG/M
3300022167|Ga0212020_1050150Not Available708Open in IMG/M
3300022183|Ga0196891_1003120All Organisms → Viruses → Predicted Viral3533Open in IMG/M
3300022183|Ga0196891_1098010Not Available516Open in IMG/M
3300022187|Ga0196899_1010827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20113600Open in IMG/M
(restricted) 3300024518|Ga0255048_10662525Not Available504Open in IMG/M
3300025070|Ga0208667_1005578All Organisms → Viruses → Predicted Viral3370Open in IMG/M
3300025070|Ga0208667_1014257Not Available1703Open in IMG/M
3300025083|Ga0208791_1007711All Organisms → Viruses → Predicted Viral2720Open in IMG/M
3300025098|Ga0208434_1014624All Organisms → Viruses → Predicted Viral2067Open in IMG/M
3300025108|Ga0208793_1034592Not Available1654Open in IMG/M
3300025653|Ga0208428_1018031Not Available2352Open in IMG/M
3300025653|Ga0208428_1139884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300025653|Ga0208428_1145255All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium638Open in IMG/M
3300025671|Ga0208898_1065572All Organisms → Viruses → Predicted Viral1233Open in IMG/M
3300025671|Ga0208898_1067302Not Available1208Open in IMG/M
3300025671|Ga0208898_1085139Not Available1004Open in IMG/M
3300025671|Ga0208898_1109844Not Available819Open in IMG/M
3300025671|Ga0208898_1144573Not Available651Open in IMG/M
3300025759|Ga0208899_1031875Not Available2455Open in IMG/M
3300025759|Ga0208899_1188880Not Available665Open in IMG/M
3300025769|Ga0208767_1019078Not Available3878Open in IMG/M
3300025769|Ga0208767_1160745All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011804Open in IMG/M
3300025815|Ga0208785_1010125Not Available3412Open in IMG/M
3300025840|Ga0208917_1208021Not Available648Open in IMG/M
3300025840|Ga0208917_1250113Not Available569Open in IMG/M
3300025853|Ga0208645_1021330All Organisms → Viruses → Predicted Viral3559Open in IMG/M
3300025853|Ga0208645_1105673All Organisms → Viruses → Predicted Viral1155Open in IMG/M
3300025889|Ga0208644_1077931Not Available1710Open in IMG/M
3300034374|Ga0348335_015423Not Available3918Open in IMG/M
3300034374|Ga0348335_053053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20111547Open in IMG/M
3300034374|Ga0348335_087859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1023Open in IMG/M
3300034374|Ga0348335_120564Not Available778Open in IMG/M
3300034375|Ga0348336_021489Not Available3318Open in IMG/M
3300034418|Ga0348337_041749All Organisms → Viruses → Predicted Viral1955Open in IMG/M
3300034418|Ga0348337_057714All Organisms → Viruses → Predicted Viral1504Open in IMG/M
3300034418|Ga0348337_079160All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300034418|Ga0348337_173806Not Available573Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous78.69%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.56%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.10%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.46%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.64%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.64%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.64%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.82%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.82%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.82%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.82%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1006760533300000101MarineMQQTSKQALTANRIAATVTATKPVKIGGSFVLDFSNPRYAKRE*
DelMOSum2010_1020529233300000101MarineMQQTARQAVAARRIAATVTATKPVKIGGSFVLDFSDKPERRFIE*
DelMOSum2011_1009929723300000115MarineMGMTQQTSKQALMANRIAATVTATKPVKIGSVSVLDFSDRPKRRFIE*
DelMOWin2010_1001775643300000117MarineMQQTNKQALAASRVAATVEAAKPVKIGNSFVLDFSNPRHVKRE*
DelMOWin2010_1024812713300000117MarineMQQTSKQALTANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE*
Ga0075474_1001025973300006025AqueousMQQTSKQALAANRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG*
Ga0075474_1018079533300006025AqueousMVKQQANKQALAANRVAATVEAAKPVKIGSSYVLDFSSKPKRRFTG*
Ga0075478_1000963013300006026AqueousMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSSKPKRRFTG*
Ga0075478_1002698813300006026AqueousMQQTSKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG*
Ga0075462_1008288623300006027AqueousMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG*
Ga0075461_1001728873300006637AqueousMGLKQQTTRQALIANRIAATVEAAKPTKIGNSFVLDFSDRPKRRFIE*
Ga0098048_101245723300006752MarineMVKQQTSKQALAANRIAATVTATKPVKIGGSFVLDFSARPKRRFTG*
Ga0070749_1014003343300006802AqueousMVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG*
Ga0070749_1028468113300006802AqueousMQQTSKQALAANRVAETVEAAKPVKIGSSYVLDFSNKPKRRFTG*
Ga0070754_1007372033300006810AqueousMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE*
Ga0070754_1007774123300006810AqueousMGLKQQTTRQALIANRIAATVEAAKPTKIGNSFLLDFSDRPKRRFIE*
Ga0070754_1012284543300006810AqueousMQQANKQALAANRVAATVEAAKPIKIGSSYVLDFSDKPKRRFTG*
Ga0070754_1013622123300006810AqueousMQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE*
Ga0070754_1015018723300006810AqueousMVKQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG*
Ga0070754_1018385333300006810AqueousMVMQQTTKRALAANRIAATVEAAKPVKIGNSFVLDFSNKPKRRFTG*
Ga0070754_1023273123300006810AqueousMQQTTKQALTASRIAATVEATKPMKIGNSFVLDFSNPRHVKRE*
Ga0070754_1030734623300006810AqueousMVMQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG*
Ga0070754_1034208523300006810AqueousMVMQQANKQALAASRIAATVEAAKPVKIGSSFVLDFSSKPKRRFTG*
Ga0070754_1048297233300006810AqueousMQQANKQALAASRLAATVEATKPVKIGSSYVLDFSNKPKRRFTG*
Ga0070754_1051690523300006810AqueousMQQTSKQALAASRIAATVEATKPVKIGNSFVLDFSNPRHVK
Ga0075476_1006378633300006867AqueousMVKQQANKRALTANRVAATVEATKPVKIGSSYVLDFSDKPKRRFTG*
Ga0075476_1024490223300006867AqueousMVMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE*
Ga0075476_1029349123300006867AqueousMQQANKQALAASRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG*
Ga0075481_1002169223300006868AqueousMQQTNRQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE*
Ga0075481_1009741423300006868AqueousMVMQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE*
Ga0075481_1022801423300006868AqueousTTKQALTANRIAATVTATKPVKVGGSFVLDFSDRPKRRFIE*
Ga0075477_1044417713300006869AqueousMVKQQANKQALAASRIAATVAATKPMKIGNSFVLDFSDKPK
Ga0075479_1028826613300006870AqueousMVKQQANKRALTANRVAATVEATKPVKIGSSYVLDFSSKPKRRFTG*
Ga0075475_1020347623300006874AqueousMQQTTKQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE*
Ga0075475_1034795613300006874AqueousMQQTTKQALAANRVAATVEAAKPVKIGSSFVLDFSSKPKRRFTG*
Ga0070750_1013130323300006916AqueousMGLKQQVTRQALTANRIAATVEAAKPVKIGSSYVLDFSDKPERRFTD*
Ga0070750_1019957623300006916AqueousMQQASKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE*
Ga0070750_1021316613300006916AqueousMVMQQTNKQALAANRIAATVEAAKPVKIGNSFVLDFSNKPKRRFTG*
Ga0070750_1035039623300006916AqueousMQQTNKQALAANRIAATVEATKPVKIGNSFVLDFSNKPKRRFTG*
Ga0070750_1045255543300006916AqueousMVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPK
Ga0070746_1009603143300006919AqueousMQQTSKQALAASRIAATVEATKPTKIGNSFVLDFSNPRHAKRE*
Ga0070746_1023324913300006919AqueousMQQTTKRALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG*
Ga0070746_1030641933300006919AqueousMVMQQANKQALAANRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG*
Ga0070746_1037767323300006919AqueousMQQTTKQALAANRVAATVAATKPMKIGNSFVLDFSDKPKRRFTG*
Ga0070746_1041346013300006919AqueousMQQTTRQALAANRVAATVEATKPVKIGSSYVLDFSDKPKRRFTG*
Ga0098045_107086613300006922MarineMVKQQTSKQALAANRIAATVTATKPVKIGGSFVLDFSARPKRR
Ga0075460_1005905613300007234AqueousMELMQQTTKQALTASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG*
Ga0075463_1013324623300007236AqueousMVMQQTTKQALTASRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG*
Ga0075463_1025191513300007236AqueousMVKQQANKQALTANRVAATVEAAKPVKIGSSYVLDFSSKPKRRFTG*
Ga0070745_112050423300007344AqueousMQQTSKQALAASRIAATVEAAKPVKVGNSFVLDFSSKPRRRFIE*
Ga0070745_120412723300007344AqueousMQQTTKQALAASRIAATVEATKPMKIGNSFVLDFSNPRHVKRE*
Ga0070745_121421033300007344AqueousMQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG*
Ga0070745_122454423300007344AqueousMELMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG*
Ga0070745_129666013300007344AqueousMVMQQTTKQALTASRVAATVEAATPVKIGSSYVLD
Ga0070753_105408953300007346AqueousMQQTTKQALAASRVAATVAATKPMKIGNSFVLDFSDKPKRRFTG*
Ga0070753_111228113300007346AqueousMGLKQQVTRQALTANRIAATVEAAKPVKIGNSFVLDFSDRPKRRFIE*
Ga0070753_114383513300007346AqueousMQQTTKQALTASRVAATVEATKPVKIGSSYVLDFSDKPKRRFTG*
Ga0070753_115755713300007346AqueousMQQTTKQALAANRVAATVEAAKPVKIGNSFVLDFSSKPKRRFTG*
Ga0070753_117510723300007346AqueousMQQTTKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPK
Ga0070753_120444823300007346AqueousSGKHRLQGLGLMQQTTKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE*
Ga0099849_102621723300007539AqueousMQQTSKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE*
Ga0099847_106653523300007540AqueousMGMMQQTSKQALMASRIAATVTATKPVKVGSSYVLDFSDKPKRRFIE*
Ga0070751_121860233300007640AqueousMQQTTKKALAANRVAATVEAAKPVKIGSSYVLDFSNKPKR
Ga0070751_126835813300007640AqueousMQQTTKQALTANRVAATVEAAKPVKIGNSFVLDFSDKPKRRFTG*
Ga0070751_129194323300007640AqueousMVKQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFT
Ga0075480_1013957413300008012AqueousQQTTKQALTASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG*
Ga0075480_1042864813300008012AqueousMQQTSKQALAASRIAATVEATKPMKIGNSFVLDFSNKPKRRFTG*
Ga0075480_1047996713300008012AqueousMQQTTKQALTASRVAATVEATKPVKIGNSFVLDFSDKSKRRF
Ga0075480_1051919713300008012AqueousMVMQQTSKQALAASRIAATVEATKPVKIGSSYVLDFSDKPKRRFTD*
Ga0115572_1020289023300009507Pelagic MarineMGMMQQTSKQALMASRIAATVAATKPVKIGSVSVLDFSDRPKRRFIE*
Ga0098049_109670843300010149MarineMVKQQTSKQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE*
Ga0129348_100737913300010296Freshwater To Marine Saline GradientSKQALTANRVAATVEATKPVKIGNSFVLDFSNKPKRRFTG*
Ga0129345_130006013300010297Freshwater To Marine Saline GradientMVKQQTTKQALAANRVAATVEAAKPTKIGNSFVLDFSDKPKRRFTG*
Ga0151671_102475813300011253MarineTTSQALASRRMAATVAATKPVKVGGSFVLDFSDRPKRRFIE*
Ga0180120_1021419033300017697Freshwater To Marine Saline GradientMGLKQQTSKQALMANRIAATVEATKPTKIGSVSVLDFSDKPE
Ga0181410_114144723300017763SeawaterALTANRIAATVTATKPVRVGSVSVLDFSNPRHAKRE
Ga0181425_123811013300017771SeawaterQALTANRLAATVTATKPVRVGSVSVLDFSARPKRRFTG
Ga0194023_104158413300019756FreshwaterMQQANKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG
Ga0194023_105734623300019756FreshwaterMQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE
Ga0206128_109783323300020166SeawaterMQQSKQALAASRIAATVTATKPVKIGGSFVLDFSNPRHAKRE
Ga0213865_1021618723300021373SeawaterMGLKQQATRQALTANRIAATVTATKPVKIGNSFVLDFSNKSKRRFIE
Ga0213866_1003208923300021425SeawaterMGLKQQTTRQALAANRIAATVEATKPTKIGSVSVLDFSDKPERRFTG
Ga0212024_101252023300022065AqueousMVMQQASKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE
Ga0212024_105882033300022065AqueousMQQTTKQALAANRVAATVAATKPMKIGNSFVLAFS
Ga0212028_100212663300022071AqueousMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSSKPKRRFTG
Ga0212020_105015033300022167AqueousMQQANKQALAANRVAATVEAAKPIKIGSSYVLDFSDKPKRRFTG
Ga0196891_100312043300022183AqueousMGLKQQTTRQALIANRIAATVEAAKPTKIGNSFVLDFSDRPKRRFIE
Ga0196891_109801023300022183AqueousMQQASKQALAANRIAATVEATKPTKIGNSFVLDFSNPRYAKRE
Ga0196899_101082773300022187AqueousMQQTSKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG
(restricted) Ga0255048_1066252523300024518SeawaterMMQQTSRQALAASRIAATVAATKPVKIGSSFVLDFSARPKRRF
Ga0208667_100557833300025070MarineMVKQQTSKQALAANRIAATVTATKPVKIGGSFVLDFSARPKRRFTG
Ga0208667_101425743300025070MarineQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE
Ga0208791_100771143300025083MarineMVKRQTSKQALAANRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE
Ga0208434_101462413300025098MarineMVKQQTSKQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKR
Ga0208793_103459243300025108MarineMVKQQTSKQAQAARRIAATVEAAKPVKVGSSFVLDFSNPRHAKRE
Ga0208428_101803123300025653AqueousMQQTTKQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE
Ga0208428_113988433300025653AqueousMQQTTKQALTASRVAATVEAAKPVKIGSSYVLDFS
Ga0208428_114525533300025653AqueousMVMQQTTKQALTASRVAATVEATKPMKIGNSFVLDF
Ga0208898_106557213300025671AqueousMVMQQTSKQALAASRIAATVEAAKPVKVGNSFVLDFSSKPRRRFIE
Ga0208898_106730223300025671AqueousMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE
Ga0208898_108513913300025671AqueousMQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG
Ga0208898_110984413300025671AqueousMQQTTKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKRRFTG
Ga0208898_114457313300025671AqueousMELMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG
Ga0208899_103187513300025759AqueousMQQTTKQALAANRVAATVAATKPMKIGNSFVLDFSDKPKRRFTG
Ga0208899_118888013300025759AqueousMVMQQTNKQALAANRIAATVEAAKPVKIGNSFVLDFSNKPKRRFTG
Ga0208767_101907823300025769AqueousMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG
Ga0208767_116074533300025769AqueousMVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFS
Ga0208785_101012573300025815AqueousMQQTSKQALAANRIAATVEATKPVKIGNSFVLDFSSKPKRRFTG
Ga0208917_120802113300025840AqueousLSRQHRFQGMVMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE
Ga0208917_125011313300025840AqueousALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE
Ga0208645_102133013300025853AqueousMVMQQTTKQALTASRIAATVEATKPVKIGNSFVLDFSNPRHVKRE
Ga0208645_110567313300025853AqueousMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG
Ga0208644_107793123300025889AqueousMVMQQTNKQALAANRIAATVEAAKPVKIGNSFVLDFSNPRYAKRE
Ga0348335_015423_959_10963300034374AqueousMVMQQTTRQALTANRIAATVEATKPKKIGNSFVLDFSNPRYAKRE
Ga0348335_053053_1426_15453300034374AqueousMQQTSKQALAANRVAATVEAAKPVKIGSSYVLDFSNKPKR
Ga0348335_087859_806_9463300034374AqueousMVMQQTTKQALTASRVAATVEATKPMKIGNSFVLDFSDKPKRRFTG
Ga0348335_120564_624_7553300034374AqueousMQQTTKQALAANRVAATVEATKPVKIGNSFVLDFSNPRYAKRE
Ga0348336_021489_3_1133300034375AqueousMQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSNP
Ga0348337_041749_12_1523300034418AqueousMVMQQTTKQALAASRVAATVAAAKPTKIGNSFVLDFSDKPKRRFTG
Ga0348337_057714_1339_14733300034418AqueousMQQTSKQALAASRIAATVEATKPVKIGSSYVLDFSSKPKRRFTG
Ga0348337_079160_922_10623300034418AqueousMVKQQTSKQALAANRVAATVEATKPVKIGNSFVLDFSDKPKRRFTG
Ga0348337_173806_2_1153300034418AqueousALTANRIAATVEAAKPTKIGNSFVLDFSNKPKRRFTG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.