NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071534

Metagenome / Metatranscriptome Family F071534

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071534
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 41 residues
Representative Sequence VGQADDLPAIRPYERDLPDISNDVRQQAVETEKAIRERAK
Number of Associated Samples 109
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 88.52 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.689 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.115 % of family members)
Environment Ontology (ENVO) Unclassified
(23.770 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.475 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.65%    β-sheet: 0.00%    Coil/Unstructured: 57.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF12838Fer4_7 22.95
PF00903Glyoxalase 22.95
PF00436SSB 9.84
PF00326Peptidase_S9 4.92
PF00877NLPC_P60 2.46
PF14559TPR_19 1.64
PF06782UPF0236 0.82
PF00128Alpha-amylase 0.82
PF03745DUF309 0.82
PF06172Cupin_5 0.82
PF05746DALR_1 0.82
PF01434Peptidase_M41 0.82
PF12704MacB_PCD 0.82
PF01161PBP 0.82
PF04405ScdA_N 0.82
PF01977UbiD 0.82
PF00006ATP-synt_ab 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 9.84
COG2965Primosomal replication protein NReplication, recombination and repair [L] 9.84
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 2.46
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.82
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.82
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.82
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.82
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.82
COG0751Glycyl-tRNA synthetase, beta subunitTranslation, ribosomal structure and biogenesis [J] 0.82
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.82
COG1547Predicted metal-dependent hydrolaseFunction unknown [S] 0.82
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.82
COG2846Iron-sulfur cluster repair protein YtfE, RIC family, contains ScdAN and hemerythrin domainsPosttranslational modification, protein turnover, chaperones [O] 0.82
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.82
COG3542Predicted sugar epimerase, cupin superfamilyGeneral function prediction only [R] 0.82

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.69 %
UnclassifiedrootN/A21.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101342337All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300001084|JGI12648J13191_1028694Not Available547Open in IMG/M
3300001593|JGI12635J15846_10171676All Organisms → cellular organisms → Bacteria → Acidobacteria1464Open in IMG/M
3300002245|JGIcombinedJ26739_100339799Not Available1383Open in IMG/M
3300002562|JGI25382J37095_10269258All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300004091|Ga0062387_101650122All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300004092|Ga0062389_101763641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300004971|Ga0072324_1233632All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300005174|Ga0066680_10313947All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300005591|Ga0070761_10270002All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300005591|Ga0070761_10633334All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005602|Ga0070762_11182618Not Available529Open in IMG/M
3300005891|Ga0075283_1073463All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006028|Ga0070717_10589751All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300006028|Ga0070717_10968280All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300006050|Ga0075028_100288012All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006052|Ga0075029_100793426All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006173|Ga0070716_101607584All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300006174|Ga0075014_100903725All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300006642|Ga0075521_10397661All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300006755|Ga0079222_10280670All Organisms → cellular organisms → Bacteria → Acidobacteria1072Open in IMG/M
3300006854|Ga0075425_101079134All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300006871|Ga0075434_101392084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300009089|Ga0099828_10073355All Organisms → cellular organisms → Bacteria2904Open in IMG/M
3300009521|Ga0116222_1243101Not Available776Open in IMG/M
3300009525|Ga0116220_10121329All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300009672|Ga0116215_1200852All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300009700|Ga0116217_10632487Not Available665Open in IMG/M
3300009762|Ga0116130_1159482All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300009824|Ga0116219_10384328Not Available784Open in IMG/M
3300009839|Ga0116223_10519725Not Available692Open in IMG/M
3300009839|Ga0116223_10592877All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300010043|Ga0126380_10894819Not Available737Open in IMG/M
3300010048|Ga0126373_10176166All Organisms → cellular organisms → Bacteria → Acidobacteria2054Open in IMG/M
3300010325|Ga0134064_10021139All Organisms → cellular organisms → Bacteria → Acidobacteria1844Open in IMG/M
3300010376|Ga0126381_101574433All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300011064|Ga0138525_1012565All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300011120|Ga0150983_14367616Not Available610Open in IMG/M
3300011120|Ga0150983_15020508All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300011120|Ga0150983_16103145All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300011269|Ga0137392_10045550All Organisms → cellular organisms → Bacteria3275Open in IMG/M
3300011270|Ga0137391_10038183All Organisms → cellular organisms → Bacteria4062Open in IMG/M
3300012207|Ga0137381_11118907Not Available677Open in IMG/M
3300012210|Ga0137378_11499583Not Available585Open in IMG/M
3300012989|Ga0164305_10441403All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300014164|Ga0181532_10069794All Organisms → cellular organisms → Bacteria2255Open in IMG/M
3300014657|Ga0181522_10146109All Organisms → cellular organisms → Bacteria → Acidobacteria1381Open in IMG/M
3300016294|Ga0182041_10093002All Organisms → cellular organisms → Bacteria2191Open in IMG/M
3300017955|Ga0187817_10211484All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300017970|Ga0187783_10064207All Organisms → cellular organisms → Bacteria → Acidobacteria2707Open in IMG/M
3300017970|Ga0187783_10181723All Organisms → cellular organisms → Bacteria → Acidobacteria1548Open in IMG/M
3300017970|Ga0187783_10880813Not Available645Open in IMG/M
3300017974|Ga0187777_10059158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2472Open in IMG/M
3300018006|Ga0187804_10578265All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300018008|Ga0187888_1260224All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300018017|Ga0187872_10009917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6036Open in IMG/M
3300018038|Ga0187855_10040100All Organisms → cellular organisms → Bacteria → Acidobacteria2957Open in IMG/M
3300018042|Ga0187871_10037942All Organisms → cellular organisms → Bacteria → Acidobacteria2969Open in IMG/M
3300018086|Ga0187769_11265827All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300019268|Ga0181514_1623650All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300020582|Ga0210395_11314631Not Available529Open in IMG/M
3300020583|Ga0210401_10363982All Organisms → cellular organisms → Bacteria → Acidobacteria1308Open in IMG/M
3300021401|Ga0210393_11557314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300021402|Ga0210385_11012924All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300021407|Ga0210383_10505644All Organisms → cellular organisms → Bacteria → Acidobacteria1043Open in IMG/M
3300021420|Ga0210394_11302932All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300021432|Ga0210384_11011970All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300021433|Ga0210391_10890073All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300021433|Ga0210391_10989640Not Available655Open in IMG/M
3300021433|Ga0210391_11134034All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300021474|Ga0210390_11584419All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300021559|Ga0210409_10557742All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300022504|Ga0242642_1066829All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300022522|Ga0242659_1066677All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300022717|Ga0242661_1101429All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300022724|Ga0242665_10168580All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300023259|Ga0224551_1103409Not Available504Open in IMG/M
3300025898|Ga0207692_10393432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300025928|Ga0207700_10970624All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300025929|Ga0207664_11986627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300026323|Ga0209472_1116783All Organisms → cellular organisms → Bacteria → Acidobacteria1050Open in IMG/M
3300026524|Ga0209690_1078429All Organisms → cellular organisms → Bacteria → Acidobacteria1395Open in IMG/M
3300027370|Ga0209010_1092990All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027505|Ga0209218_1101736Not Available601Open in IMG/M
3300027698|Ga0209446_1188647Not Available531Open in IMG/M
3300027706|Ga0209581_1162590All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300027853|Ga0209274_10510335All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300027884|Ga0209275_10837928All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300027905|Ga0209415_10216901All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300027905|Ga0209415_10829551Not Available639Open in IMG/M
3300028015|Ga0265353_1028659Not Available554Open in IMG/M
3300028785|Ga0302201_10226062All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300028882|Ga0302154_10344076All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300029908|Ga0311341_10449556All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300030044|Ga0302281_10313229All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300030058|Ga0302179_10511232All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300030399|Ga0311353_10106399All Organisms → cellular organisms → Bacteria2723Open in IMG/M
3300030580|Ga0311355_10631647All Organisms → cellular organisms → Bacteria → Acidobacteria1006Open in IMG/M
3300030659|Ga0316363_10197053All Organisms → cellular organisms → Bacteria → Acidobacteria841Open in IMG/M
3300030659|Ga0316363_10224841Not Available772Open in IMG/M
3300030760|Ga0265762_1100697All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031122|Ga0170822_10359519All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300031231|Ga0170824_104371044All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300031231|Ga0170824_124697893All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300031474|Ga0170818_107413569All Organisms → cellular organisms → Bacteria → Acidobacteria1158Open in IMG/M
3300031708|Ga0310686_116542541Not Available622Open in IMG/M
3300031720|Ga0307469_11225524All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300031753|Ga0307477_10915136Not Available578Open in IMG/M
3300031820|Ga0307473_11447729All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300031823|Ga0307478_10248723All Organisms → cellular organisms → Bacteria → Acidobacteria1444Open in IMG/M
3300031912|Ga0306921_11648410All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300032001|Ga0306922_12026327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300032160|Ga0311301_11574062Not Available802Open in IMG/M
3300032180|Ga0307471_100147778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2253Open in IMG/M
3300032515|Ga0348332_11004445All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300032770|Ga0335085_11372266All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300032783|Ga0335079_12218172Not Available523Open in IMG/M
3300032892|Ga0335081_10009749All Organisms → cellular organisms → Bacteria15477Open in IMG/M
3300032896|Ga0335075_11597529All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300032898|Ga0335072_10755483Not Available939Open in IMG/M
3300032898|Ga0335072_10964131Not Available788Open in IMG/M
3300033405|Ga0326727_11143195All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.11%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil11.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.10%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.10%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.28%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.28%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.46%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.46%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.46%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.46%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.64%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.82%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.82%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.82%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.82%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004971Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011064Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028015Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10134233723300000364SoilLIGQPEDLPAIRPYERDVPDVSNDVRQQAQETEKAIHARAR*
JGI12648J13191_102869413300001084Forest SoilQLDDLPAIRPYERDLPDISNDVRQQALETERAIHERTSK*
JGI12635J15846_1017167613300001593Forest SoilGQPDDIPAILPYERDLPDIPVHVRQQALETEKAIRAREK*
JGIcombinedJ26739_10033979913300002245Forest SoilYLIGQPDDLPAIRPYERNLPDVSNNVRQQAIETEQAIRKRSGS*
JGI25382J37095_1026925813300002562Grasslands SoilLYLIGKPEDIPAIQSYERDLPDIPEHVREQAAETERAIRQRGK*
Ga0062387_10165012213300004091Bog Forest SoilALYLIGQSEDLPAIRRYERDVPEVSNDVRQQAVETEKAIVQRSQH*
Ga0062389_10176364113300004092Bog Forest SoilLIGQPDDLPAIRPYQRDLADISNDVRQQAMETEQAIKKRSGQ*
Ga0072324_123363233300004971Peatlands SoilQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQSRAGAH*
Ga0066680_1031394713300005174SoilLIGQLEDLPAIQPYERSLPDIPERVKQQAVLAEKAIRERAK*
Ga0070761_1027000213300005591SoilRALYLIGQLEDLPAILPYERDLPDISTDVRQQAIETENAIRSREAH*
Ga0070761_1063333413300005591SoilRALYLIGQPDDLSAIRPYERDLPDISNDVRQQAVESEQAIRNRTSK*
Ga0070762_1118261823300005602SoilLDDLSAIRPYERDLPDISNDVRQQAEQTEKAIRTRAGTPTTTAQ*
Ga0075283_107346323300005891Rice Paddy SoilDLPAVTPYERDVPEISAQVRQQATETEKAIRQRARL*
Ga0070717_1058975133300006028Corn, Switchgrass And Miscanthus RhizosphereLIGQPEDLPAIRPYERDVPDVSNDVRQQAQETEKAIQARVK*
Ga0070717_1096828033300006028Corn, Switchgrass And Miscanthus RhizosphereGQADDLAAIRPYERDVPDVSNDVRQQAQETERAIRGRTSVH*
Ga0075028_10028801233300006050WatershedsLYLIGQPEDLDAIRPYERDLPDISNAVRQQASETEQAIRKRAGLN*
Ga0075029_10079342623300006052WatershedsAVRPYERELPDVSNDVRQQALETDKAIRARAGVN*
Ga0070716_10160758413300006173Corn, Switchgrass And Miscanthus RhizosphereRALYLVGLPEDLDAIRPYQRDLPSISNDVRKQAVEAEKAIQARAAK*
Ga0075014_10090372523300006174WatershedsYIVGQIDDLPAIRMYERDLPDISNDVRKQALETEKAIRARAG*
Ga0075521_1039766113300006642Arctic Peat SoilLYLVGQVDDLAAIRPYERDLPDISNDVRQQAQETEKAIRDRSANK*
Ga0079222_1028067013300006755Agricultural SoilALRALYIIGQPDDLPAVRRYERDLPDISNDIRQQALETEKAIQNRVVPAQP*
Ga0075425_10107913413300006854Populus RhizospherePAIRPYQRELPEIPDHVRKQAVETEQAIRRRVPGPL*
Ga0075434_10139208423300006871Populus RhizosphereLYVIGQPDDLNAVLPYQRDLPNISNDIRQQAMETEKAIRSRAAAAQP*
Ga0099828_1007335563300009089Vadose Zone SoilVVGQPDELAAISPYARELRDISNDVRQEAVETEKAILGRAK*
Ga0116222_124310113300009521Peatlands SoilQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN*
Ga0116220_1012132913300009525Peatlands SoilVGQADDLPAIRPYERDLPDISNDVRQQAVETEKAIRERAK*
Ga0116215_120085213300009672Peatlands SoilDLPAIRPYERDLPDISNDVRRQAVETEKAIQSRNQH*
Ga0116217_1063248723300009700Peatlands SoilYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN*
Ga0116130_115948223300009762PeatlandIGQPDDLSAIQPYERDLPDISNDVRQQAVETEKAIRARMK*
Ga0116219_1038432823300009824Peatlands SoilALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN*
Ga0116223_1051972513300009839Peatlands SoilRALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN*
Ga0116223_1059287713300009839Peatlands SoilRALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQSRAGAH*
Ga0126380_1089481913300010043Tropical Forest SoilLPAIRPYERDLADVSNDVRQQAQQTEKAIQSRAQ*
Ga0126373_1017616633300010048Tropical Forest SoilPDDLAAVRPYERDLPDISNDVRLQATDTEKAIRERTDAQSSPDATR*
Ga0134064_1002113943300010325Grasslands SoilQADDIPAINPYERDLPDIPEHVREQAAETERAIRQRGK*
Ga0126381_10157443313300010376Tropical Forest SoilGQPDDLSAVLRYQRDLPNISNDIRQQAIETEKAIRSRAAPAQP*
Ga0138525_101256523300011064Peatlands SoilALRALYVVGQLDDLAAIRPYERDLPDVSNDMRQQAVETEKAIQSRAK*
Ga0150983_1436761613300011120Forest SoilAIRPYERDLADISNDVRQQAVETEQAIEKRSGSQ*
Ga0150983_1502050823300011120Forest SoilVVGQMDDLAAVRPYERELPEISNDVRLQAAATEKAIRSRAGVD*
Ga0150983_1610314523300011120Forest SoilRALYLVGQPDDIAAVLPYERESPDIPDHVRQQAVETVRAIRLREEAVD*
Ga0137392_1004555013300011269Vadose Zone SoilLIGQPDDLAAIRPYERDLPDVSNDVRRQAQETEQAIRKRSGS*
Ga0137391_1003818343300011270Vadose Zone SoilQPDDLAAIRPYERDLPDVSNDVRRQAHETEQAIRKRSGS*
Ga0137381_1111890713300012207Vadose Zone SoilIVGQMDDLTAIRPYERDLPDISNDVRQQAAETEKAIQTRSTATNK*
Ga0137378_1149958313300012210Vadose Zone SoilLYLVGQIGDLAAIQPYERDLPDISNNVRQQALETEKAIRARAGVN*
Ga0164305_1044140333300012989SoilLYLIGQPEDISSIQPYERDLPDVSNDVRQQAEQTEKAIRARSEN*
Ga0181532_1006979413300014164BogIEDLPAIVPYERDLPDISNDVRQQAAETEKAIRERAK*
Ga0181522_1014610913300014657BogDLPAIRPYERDLPDISNDVRQQAQETEKAIQLRGK*
Ga0182041_1009300253300016294SoilYLVGQPEDIAAILPYERDLPDTPDQVRQQAVETEKAIRDREK
Ga0187817_1021148433300017955Freshwater SedimentALYLVGQVDDLAAIRPYERDLPDISNDVRQQAQETEKAIQGRNQN
Ga0187783_1006420723300017970Tropical PeatlandLYLVGQPEDIAAILPYERDLPDTSDRVRQQAIETEKAIRERDK
Ga0187783_1018172313300017970Tropical PeatlandLIGQPEDIPAILPYERELLDISDDVRKQAAETERAIRERTK
Ga0187783_1088081323300017970Tropical PeatlandRALYLIGQPDDLAAIRPYQRDLPDISNDVRQQAMETEQAIRRRDSR
Ga0187777_1005915833300017974Tropical PeatlandEDIAAILPYERDLPDTPDQVRQQAIETEKAIRDREK
Ga0187804_1057826513300018006Freshwater SedimentPEDLPAIRSYQRDLPDISNDIRQQAVETEKSINNRATAPPK
Ga0187888_126022413300018008PeatlandLRALYLIGQPDDLAAIRPYERDLADISNDVRQQAAETERAIQQRAK
Ga0187872_1000991713300018017PeatlandYLVGQMDNLAAIRPYERNLPNIPDHVRQQALETEKAIRTRASMN
Ga0187855_1004010013300018038PeatlandLYLVGQIDDLAAVLPYERDLPDISNDVRQQAVETEKAIRQRAKS
Ga0187871_1003794213300018042PeatlandGQPEDLPAILPYERDLPDISTDVRQQAIETEKAIRSR
Ga0187769_1126582723300018086Tropical PeatlandDIAAVQPFERELPDISNDVRQQAIETERAIRDRSH
Ga0181514_162365023300019268PeatlandVGQLDDLAAIRPYERDLPDISNDVRQQAVETEKAIVARAGSN
Ga0210395_1131463123300020582SoilDDLPAIRLYQRDLPDVSNDVRQQAMETEKAIRARTGSN
Ga0210401_1036398213300020583SoilLVGQSDDLAAVRPYERDLPDISNDVRQQALETEKAIRGRSLAPSDK
Ga0210393_1155731423300021401SoilLIGQPDDIPAIRSYERDLPDVSNDVRQQALETEQAIRKRSGS
Ga0210385_1101292423300021402SoilALYLIGQPEDIAAVSPYERELPDISNDVRNQAVETEKAIRQRER
Ga0210383_1050564443300021407SoilRALYVVGQIDDLPAIRPYERDLPDISNDVRQQASETERAIQARNQR
Ga0210394_1130293213300021420SoilTDDLPAIRPYERDLPDVSSDVRRQAAETEQAIQKRSGS
Ga0210384_1101197013300021432SoilRALYLVGQPDDLSAIRPYERDLPDISNDVRQQALETDKAIRARAQVVEDRN
Ga0210391_1089007323300021433SoilFDDLPAIRPYERDLPDISNDVRQQAAETEKAIRKRSGE
Ga0210391_1098964023300021433SoilDLAAIRPYERELPEISNDVRQQAVETEKAIRTRADKNGPS
Ga0210391_1113403423300021433SoilLYVVGQRDDLTAVLPYERDLPGISNDVRQQALETEKAIRARAEKNGPS
Ga0210390_1158441923300021474SoilRALYLVGQINDLPAIRPYERDLPDISNDVRQQAVETEKAIQNRNQH
Ga0210409_1055774223300021559SoilLPAIRPYERDLSDISNDVRQQAVETEQAIRKRSGS
Ga0242642_106682913300022504SoilGQPDDLPAIRPYERDLPDISNDVRHQAAETEKAIQTRSAAPNK
Ga0242659_106667723300022522SoilYLVGEAEDIPSVLPYERELPDISNDVREQATITERAIRERTK
Ga0242661_110142923300022717SoilEDIPSVLPYERELPDISNDVREQATITERAIRERTK
Ga0242665_1016858013300022724SoilYLIGQPEDIAAVSPYERELPDVSNDVRLQAMETEKAIRQRER
Ga0224551_110340923300023259SoilDDLPAILPYERDLPDISNDVRQQAAEAERAIRERVK
Ga0207692_1039343233300025898Corn, Switchgrass And Miscanthus RhizosphereVLPYERDLPNISNDIRQQAVETDKAIRNRVVPAQP
Ga0207700_1097062413300025928Corn, Switchgrass And Miscanthus RhizosphereLIGQPEDLPAIRPYERDVPDVSNDVRQQAQETEKAIQARVK
Ga0207664_1198662723300025929Agricultural SoilVIGQPDDLAAVLPYERDLPNVSNDIRQQAVETEKAIRSRVAPAQP
Ga0209472_111678313300026323SoilGQPEDIPAIQPYERDLPDIPEHVREQAVATEKAIRDRAK
Ga0209690_107842913300026524SoilALYLIGQADDIPAINPYERDLPDIPEHVREQAAETDRAIRQRGK
Ga0209010_109299023300027370Forest SoilIGQLEDLPAILPYERDLPDISTDVRQQAIETENAIRSREAH
Ga0209218_110173613300027505Forest SoilIGQLDDIPAIRPYERDLPDISNDVRQQAQETEKAIQQRAGAPTATR
Ga0209446_118864713300027698Bog Forest SoilIGQPEDIAAVSPYERELPDISNDVRKQAMETEKAIRQRER
Ga0209581_116259033300027706Surface SoilYIVGQMDDLAAIRPYERDVPDVSNDVRQQAVETEKAIRARASAN
Ga0209274_1051033513300027853SoilIDDLAAIRPYERDLPDISNDVRQQATETEKAILQRAKQ
Ga0209275_1083792813300027884SoilALYLVGQPEDTAAVLPYERELPEISNDVRKQAIETDKAIRKRANPSASD
Ga0209415_1021690133300027905Peatlands SoilIGQPDDLPAIRPYERDLPDISNDVRQQAVEAEQAIRKRSGS
Ga0209415_1082955113300027905Peatlands SoilLPRIRPYELDLPDISNDVRRQAVETEKAIQGRYQH
Ga0265353_102865913300028015SoilRALYLIGRLDDLSAIRPYERDLPDISNDVRQQAEETEKAIRTRAGTPTTTAQ
Ga0302201_1022606213300028785BogPDDLSAIRPYERDLPDVSNDVRQQAAATEEAIRKRSGS
Ga0302154_1034407613300028882BogALYLIGQEEDIPAILPYERDVPDVSDDVRRQAAETEKAIRERSK
Ga0311341_1044955623300029908BogIGQEEDIPAILPYERDVPDVSDDVRRQAAETEKAIRERSK
Ga0302281_1031322913300030044FenLIGQEEDIPAILPYERDVPDVSDDVRRQAAETEKAIRERSK
Ga0302179_1051123213300030058PalsaIGQPDDLPAIRPYQRDLPDISNDVRQQAVETEQAIRSRDSR
Ga0311353_1010639913300030399PalsaGQLDDLPAIRPYERDLPDISNDVRQQAQETEKAIQLRAK
Ga0311355_1063164713300030580PalsaDIPAIRPYERDLPDISNDVRQQAQETEKAIQQRAK
Ga0316363_1019705323300030659Peatlands SoilDIAAVSRYERELPDISNDERNQAIETEKAIRDRTK
Ga0316363_1022484113300030659Peatlands SoilGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN
Ga0265762_110069723300030760SoilQLEDLPAILPYERDLPDISTDSRQQAIETENAIRSREAH
Ga0170822_1035951913300031122Forest SoilLIGQPEDIAAVSPFEREVPDISNDVRNQAIETEKAIRERTK
Ga0170824_10437104423300031231Forest SoilLRALYIVGQLDDLTAIRPYERDLPDVSNDVRQQAAETEKAIQARSAGSANKERN
Ga0170824_12469789323300031231Forest SoilYIVGQVDDLAAIRPYERDLPDISNDVRQQAAETEKAIRARAGVS
Ga0170818_10741356933300031474Forest SoilVGQIDDLTAVLPYERDLPGISNDVHQQAQETEKAIRDRSTSK
Ga0310686_11654254123300031708SoilLPAIRPYERDLPDISNDVRQQAAETEQAIQKRSGS
Ga0307469_1122552423300031720Hardwood Forest SoilGHPEDLSAIRPYERDVPDVSNDVRQQAQETEKAIQKRSASSD
Ga0307477_1091513623300031753Hardwood Forest SoilDDLPAIRPYERDVPDVSNDVRRQAQETEKAIQARAR
Ga0307473_1144772913300031820Hardwood Forest SoilDLIMIQRYERDSPQISDRVRQQAALTEKAIRKRSAEQP
Ga0307478_1024872313300031823Hardwood Forest SoilPDDLPSVRPYERDVPEVSNDVRQQAQETEKAISKRAAPPS
Ga0306921_1164841023300031912SoilRYLVGQPEDIAAILPYERDLPDTPDQVRQQAVETEKAIRDREK
Ga0306922_1202632713300032001SoilDLSAIRPYRRDLPDVSSRVRQQASLTESAIRERANKEP
Ga0311301_1157406213300032160Peatlands SoilLRALYLVGQVDDLAAVRPYERDLPDISHDVQQQAAETEKAIQQRAHTN
Ga0307471_10014777813300032180Hardwood Forest SoilRALYLVGQWDDIPAILPYERELPEISDRVRQQALSTENAIRSGAAKVP
Ga0348332_1100444513300032515Plant LitterDIRAVSPFEREVPDISNDVRNQAIETEKAIRERTK
Ga0335085_1137226613300032770SoilYLIGQAEDLQAIRPYERDVPDVSNDVRQQAQETEKAIEARRDK
Ga0335079_1221817213300032783SoilPQDLDTIRPYERDVPDVSNDVRQQALETEKAIQARAK
Ga0335081_1000974913300032892SoilLQAVRPYERDLPDISNDVRQQAQETEKAIQLKSNH
Ga0335075_1159752913300032896SoilPDDLQAVRAYERDLPDISKDVRQQALETDQAIRRRAGTS
Ga0335072_1075548333300032898SoilDDLAVVRPYERELPDISNDVRQQALETDKAIRARAGMS
Ga0335072_1096413113300032898SoilGQPEDVAAIRPYERELPEISQRVRQQALDTEKAIQQRNR
Ga0326727_1114319523300033405Peat SoilQVDDLSAVRPYERDLPDVPNDVRQQAVETEKAIRARAK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.