NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071552

Metagenome / Metatranscriptome Family F071552

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071552
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 38 residues
Representative Sequence MLEWKFRLVILLALAGVIAVGLGNLGGLVHNFGW
Number of Associated Samples 92
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.50 %
% of genes near scaffold ends (potentially truncated) 40.16 %
% of genes from short scaffolds (< 2000 bps) 87.70 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.574 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.475 % of family members)
Environment Ontology (ENVO) Unclassified
(22.131 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.459 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00877NLPC_P60 32.79
PF00990GGDEF 13.93
PF01966HD 4.92
PF00392GntR 2.46
PF02786CPSase_L_D2 1.64
PF14016DUF4232 0.82
PF02629CoA_binding 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 32.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.57 %
UnclassifiedrootN/A34.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig90273Not Available622Open in IMG/M
2170459002|FZY7DQ102HAEABNot Available511Open in IMG/M
2170459023|GZGNO2B02GRML1All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300000953|JGI11615J12901_10386831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1673Open in IMG/M
3300001205|C688J13580_1005257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1309Open in IMG/M
3300001686|C688J18823_10027458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3876Open in IMG/M
3300001686|C688J18823_10040584All Organisms → cellular organisms → Bacteria3209Open in IMG/M
3300001686|C688J18823_10198091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1356Open in IMG/M
3300001686|C688J18823_10288955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1079Open in IMG/M
3300002568|C688J35102_120695029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1368Open in IMG/M
3300002568|C688J35102_120695138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1368Open in IMG/M
3300004081|Ga0063454_100971458Not Available680Open in IMG/M
3300004153|Ga0063455_101440414Not Available534Open in IMG/M
3300004479|Ga0062595_102105880Not Available549Open in IMG/M
3300005330|Ga0070690_101771526Not Available503Open in IMG/M
3300005332|Ga0066388_105354260Not Available651Open in IMG/M
3300005355|Ga0070671_100219013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300005435|Ga0070714_100489516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1172Open in IMG/M
3300005439|Ga0070711_100256615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1374Open in IMG/M
3300005450|Ga0066682_10126440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1618Open in IMG/M
3300005526|Ga0073909_10049637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1518Open in IMG/M
3300005532|Ga0070739_10009954All Organisms → cellular organisms → Bacteria9293Open in IMG/M
3300005538|Ga0070731_11162190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300005553|Ga0066695_10104014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1742Open in IMG/M
3300005554|Ga0066661_10827847Not Available541Open in IMG/M
3300005560|Ga0066670_10478214Not Available767Open in IMG/M
3300005560|Ga0066670_10556325Not Available701Open in IMG/M
3300005563|Ga0068855_100149545All Organisms → cellular organisms → Bacteria2655Open in IMG/M
3300005563|Ga0068855_100592225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1197Open in IMG/M
3300005563|Ga0068855_100706297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1079Open in IMG/M
3300005563|Ga0068855_101513076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300005564|Ga0070664_101103746Not Available747Open in IMG/M
3300005576|Ga0066708_10451248Not Available826Open in IMG/M
3300005587|Ga0066654_10507767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300005614|Ga0068856_100071330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3439Open in IMG/M
3300005614|Ga0068856_100540126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1187Open in IMG/M
3300005764|Ga0066903_100097080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3956Open in IMG/M
3300005764|Ga0066903_100290063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2576Open in IMG/M
3300005764|Ga0066903_100704189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1781Open in IMG/M
3300005764|Ga0066903_100770411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1714Open in IMG/M
3300005764|Ga0066903_101167677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1426Open in IMG/M
3300005764|Ga0066903_101358899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1332Open in IMG/M
3300005764|Ga0066903_101903194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1139Open in IMG/M
3300005764|Ga0066903_104908073Not Available710Open in IMG/M
3300005891|Ga0075283_1014536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1201Open in IMG/M
3300005900|Ga0075272_1098708Not Available561Open in IMG/M
3300006028|Ga0070717_10729217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300006028|Ga0070717_11782835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300006028|Ga0070717_11917366Not Available534Open in IMG/M
3300006031|Ga0066651_10262250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300006031|Ga0066651_10464713Not Available671Open in IMG/M
3300006032|Ga0066696_10144774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1477Open in IMG/M
3300006032|Ga0066696_10764288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300006034|Ga0066656_11116985Not Available507Open in IMG/M
3300006059|Ga0075017_100137361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1732Open in IMG/M
3300006173|Ga0070716_101131257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300006581|Ga0074048_13245506Not Available609Open in IMG/M
3300006794|Ga0066658_10127655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1252Open in IMG/M
3300006804|Ga0079221_10862822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300006804|Ga0079221_11679298Not Available517Open in IMG/M
3300006852|Ga0075433_10316952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1380Open in IMG/M
3300006893|Ga0073928_10688896Not Available714Open in IMG/M
3300007076|Ga0075435_100431418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1135Open in IMG/M
3300007788|Ga0099795_10106194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1107Open in IMG/M
3300009137|Ga0066709_100936757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1264Open in IMG/M
3300009545|Ga0105237_12025923Not Available584Open in IMG/M
3300009551|Ga0105238_10042991All Organisms → cellular organisms → Bacteria4573Open in IMG/M
3300009551|Ga0105238_10745340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300009792|Ga0126374_10581173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300010159|Ga0099796_10021368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1992Open in IMG/M
3300010321|Ga0134067_10044174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1418Open in IMG/M
3300010322|Ga0134084_10048093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1248Open in IMG/M
3300010358|Ga0126370_12097145Not Available555Open in IMG/M
3300010359|Ga0126376_11200992Not Available773Open in IMG/M
3300010359|Ga0126376_12705707Not Available545Open in IMG/M
3300010361|Ga0126378_11897230Not Available678Open in IMG/M
3300010362|Ga0126377_10557946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1185Open in IMG/M
3300010366|Ga0126379_13659101Not Available515Open in IMG/M
3300010400|Ga0134122_10889471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium860Open in IMG/M
3300010400|Ga0134122_11632566Not Available670Open in IMG/M
3300012199|Ga0137383_10603501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium803Open in IMG/M
3300012207|Ga0137381_11038689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300012208|Ga0137376_10141054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2069Open in IMG/M
3300012212|Ga0150985_104511142Not Available886Open in IMG/M
3300012212|Ga0150985_117535342Not Available539Open in IMG/M
3300012285|Ga0137370_10030527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2796Open in IMG/M
3300012469|Ga0150984_104905052Not Available721Open in IMG/M
3300012469|Ga0150984_108867898Not Available549Open in IMG/M
3300012910|Ga0157308_10314096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300012924|Ga0137413_10590481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300012951|Ga0164300_10106826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1239Open in IMG/M
3300012951|Ga0164300_10359718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300012971|Ga0126369_11384631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300013104|Ga0157370_11430052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300013296|Ga0157374_12937216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300013307|Ga0157372_10796171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1098Open in IMG/M
3300013832|Ga0120132_1043297All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300015371|Ga0132258_10718320All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300015371|Ga0132258_13223339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1125Open in IMG/M
3300017937|Ga0187809_10141920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300024182|Ga0247669_1005172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2702Open in IMG/M
3300024286|Ga0247687_1009529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1288Open in IMG/M
3300024287|Ga0247690_1017280Not Available816Open in IMG/M
3300024323|Ga0247666_1054734Not Available804Open in IMG/M
3300025916|Ga0207663_10194514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1459Open in IMG/M
3300025916|Ga0207663_10741692Not Available780Open in IMG/M
3300025922|Ga0207646_11173832Not Available674Open in IMG/M
3300025924|Ga0207694_10510814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1007Open in IMG/M
3300025928|Ga0207700_10580603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium997Open in IMG/M
3300025929|Ga0207664_10522611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300025939|Ga0207665_10584100All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300025944|Ga0207661_12168952Not Available502Open in IMG/M
3300025961|Ga0207712_11864953Not Available538Open in IMG/M
3300025994|Ga0208142_1018509Not Available737Open in IMG/M
3300028802|Ga0307503_10440534Not Available689Open in IMG/M
3300031819|Ga0318568_10213994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300031938|Ga0308175_103059013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300031939|Ga0308174_10002374All Organisms → cellular organisms → Bacteria9243Open in IMG/M
3300032068|Ga0318553_10712278Not Available525Open in IMG/M
3300032893|Ga0335069_10106925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3525Open in IMG/M
3300033550|Ga0247829_11183335Not Available634Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil7.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.28%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.46%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.82%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.82%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.82%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025994Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0273.000055302166559005SimulatedSGVPTTFSPGGTMLEWKFRLVILLALAGVLAVGLGSLGGSLHHNFGW
E1_068770002170459002Grass SoilMLEWKFRLVILLALAGVLAAGLGSLGGSLHHNFGW
FA3_113287102170459023Grass SoilMLEWKFRLVILLALAGVLAVGLGSLGGSLHHNFGW
JGI11615J12901_1038683123300000953SoilMLEWKFRLVILLAAAAMIAAALGNLGWRPHNLGW*
C688J13580_100525723300001205SoilMLEWKFRLVILLALSGTIAAALGIGGLHAFNFSW*
C688J18823_1002745853300001686SoilMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW*
C688J18823_1004058413300001686SoilTTFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW*
C688J18823_1019809123300001686SoilMLEWKFRLVILMALAGMVAAAVGNLGGLIHNFSW*
C688J18823_1028895513300001686SoilMLEWKFRLVVLLAVAGTVAAALGSLGCFLPLNFNW*
C688J35102_12069502923300002568SoilTFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW*
C688J35102_12069513823300002568SoilTFSPGGTMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW*
Ga0063454_10097145823300004081SoilPGGTMLEWKFRLVILLALAGTIAAGLGHLGGLHPLNFSW*
Ga0063455_10144041413300004153SoilPTMFSPGGTMLEWKFRLVILLALSGTIAAALGIGGLHAFNFSW*
Ga0062595_10210588023300004479SoilSGVPTTFSPGGTMLEWKFRLVILLAVAGSVAAALGNLVTAHNFGW*
Ga0070690_10177152613300005330Switchgrass RhizospherePTIPPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW*
Ga0066388_10535426013300005332Tropical Forest SoilSPGGTMLEWKFRLVILLAVAGMIAAAFGNFGWHPHNFGW*
Ga0070671_10021901313300005355Switchgrass RhizosphereSPGGTMLEWKFRLVILLALAGTIATALGNLGWHSMNLGW*
Ga0070714_10048951623300005435Agricultural SoilVPGGTMLEWKFRLVTLLAFAAVLAVALGSSVAGGALNFGW*
Ga0070711_10025661523300005439Corn, Switchgrass And Miscanthus RhizosphereTTFSPGGTMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW*
Ga0066682_1012644013300005450SoilFSPGGTMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW*
Ga0073909_1004963723300005526Surface SoilMLEWKFRLVILLALAGVTAAALGNLGGLIHNFSW*
Ga0070739_1000995473300005532Surface SoilMLEWKFRLVILLAFAGMVAAAFGNLGWHPLNLGW*
Ga0070731_1116219013300005538Surface SoilMLEWKFRLVILLALAGVIAVSLGNLDGLLHCNFGW*
Ga0066695_1010401423300005553SoilMLEWKFRLVILLALAGVIAVGLGNFGGLVHNFGW*
Ga0066661_1082784713300005554SoilTMLEWKSRLVILLALAAMIAAALGNLGLSHINFGW*
Ga0066670_1047821413300005560SoilPGGTMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW*
Ga0066670_1055632513300005560SoilSPGGTMLEWKFRLVILLAVAGMTAAALGNLGGLIHNFSW*
Ga0068855_10014954523300005563Corn RhizosphereMLEWKFRLVILLALAGTIAAALGNLGWHSMNLGW*
Ga0068855_10059222523300005563Corn RhizosphereMLEWKFRLVILLALAGTVAAALGNLGGLIHNFSW*
Ga0068855_10070629723300005563Corn RhizosphereMLEWKFRLVILLALAGVIAAGLGNLAGSLHVNFGW*
Ga0068855_10151307623300005563Corn RhizosphereMLEWKFRLVILLAAAAMIAAALGNLGWHSLNLGW*
Ga0070664_10110374613300005564Corn RhizosphereGGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW*
Ga0066708_1045124813300005576SoilAEPTIPPSGVPTTYSPGGTMLEWKFRLVILLAVAGMIAAALGNLGGLIHNFSW*
Ga0066654_1050776723300005587SoilMLEWKFRLVILLAVAGMVAAAIGNFGWHPSNFSW*
Ga0068856_10007133053300005614Corn RhizosphereMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW*
Ga0068856_10054012623300005614Corn RhizosphereMLEWKFRLVILLAAAAMIAAVLGNLGWRSLQLGW*
Ga0066903_10009708023300005764Tropical Forest SoilMLEWKFRLVILMAVAGMIAAAVGNLGWHPHNLGW*
Ga0066903_10029006323300005764Tropical Forest SoilMLEWKFRLVILLALAAMLAAALGNIGGPVHNFGW*
Ga0066903_10070418923300005764Tropical Forest SoilMLEWKFRLVILLAVAGMIAAAFGNFGWHPHNFSW*
Ga0066903_10077041123300005764Tropical Forest SoilMLEWKFRLVILAALAVTVAAALGNLGWHPSNLGW*
Ga0066903_10116767723300005764Tropical Forest SoilMLEWKFRLVILLAVAGMIAAALGNFGWHPHNFSW*
Ga0066903_10135889923300005764Tropical Forest SoilMLEWKFRLVIFLALAGTVAAALGNFSWHPLNFSW*
Ga0066903_10190319423300005764Tropical Forest SoilMLEWKFRLVILLAVAGMVAAAFGNFGWHPLNFSW*
Ga0066903_10490807313300005764Tropical Forest SoilRPQFRGSGVPTTFSPGGTMLEWKFRLVILLAVAGMVAAALGNLGGAHLLNFGW*
Ga0075283_101453623300005891Rice Paddy SoilMLEWKFRLVILLAVAGMVAAALGNFGGQVFNFGW*
Ga0075272_109870823300005900Rice Paddy SoilFRSGVPTTYSPGGKMLEWKFRLVILLAVAGMVAAALGNFGGQVFNFGW*
Ga0070717_1072921713300006028Corn, Switchgrass And Miscanthus RhizosphereTISVPGGTMLEWKFRLVTLLAFAAVLAVALGSSVAGGALNFGW*
Ga0070717_1178283523300006028Corn, Switchgrass And Miscanthus RhizosphereMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW*
Ga0070717_1191736623300006028Corn, Switchgrass And Miscanthus RhizosphereMLEWKFRLVILLALAGILAVGLGNLGGLVHNFGW*
Ga0066651_1026225023300006031SoilMLEWKFRLVILLAVAGMTAAALGNLGGLIHNFSW*
Ga0066651_1046471313300006031SoilGTMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW*
Ga0066696_1014477423300006032SoilMLEWKFRLVILLALTGVIAVGLGNLGGLVRNFGW*
Ga0066696_1076428823300006032SoilMLEWKFRLVILLAVAGMVAAAFGNFGWHPLNFGW*
Ga0066656_1111698523300006034SoilSPGGTMLEWKFRLVILLALAGTVAASLGSLIANHNYGW*
Ga0075017_10013736123300006059WatershedsMLEWKSRLVILLALAGTVAAALGNLGWHPHNLGW*
Ga0070716_10113125723300006173Corn, Switchgrass And Miscanthus RhizosphereMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW*
Ga0074048_1324550613300006581SoilLSGVPTTFSPGGTMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW*
Ga0066658_1012765523300006794SoilMLEWKFRLVILLALSGTIAAALGNLGALHPLNFSW*
Ga0079221_1086282223300006804Agricultural SoilMLEWKFRLVILRALAGTIAAALGNLGWHSMNLGW*
Ga0079221_1167929813300006804Agricultural SoilSGVPTTFSPGGTMLEWKFRLVILLAAAAMIAVALGNLGGQVHNFSW*
Ga0075433_1031695213300006852Populus RhizosphereMLEWKFRLVILLALAGMTAAALGNLGGLIRNFSW*
Ga0073928_1068889613300006893Iron-Sulfur Acid SpringMLEWKFRLVILLALACTVAVALGNLGWQPNNLGW*
Ga0075435_10043141823300007076Populus RhizosphereTIPPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIRNFSW*
Ga0099795_1010619423300007788Vadose Zone SoilMLEWKFRLVTLLALAGVLAVGLGGLALPHFNFGW*
Ga0066709_10093675723300009137Grasslands SoilMLEWKFRLVILLALAGVIAVGLGNLGGLVHNFGW*
Ga0105237_1202592313300009545Corn RhizosphereTTFSPGGTMLEWKFRLVILLAVAGTIAAALGNLGGLIHNFSW*
Ga0105238_1004299123300009551Corn RhizosphereMLERKFRLVILLALAGTIAAALGNLGWHSMNLGW*
Ga0105238_1074534013300009551Corn RhizosphereTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW*
Ga0126374_1058117323300009792Tropical Forest SoilMLEWKFRLVILLAVAGMVAAALGSLPASHLNFGW*
Ga0099796_1002136823300010159Vadose Zone SoilMLEWKFRLVTLLALAGVLAVGLGGFALPHFNFGW*
Ga0134067_1004417423300010321Grasslands SoilMLEWKFRLVILLALSGTIAAAVRNLGALHALDFSW*
Ga0134084_1004809323300010322Grasslands SoilMLEWKFRLVILLALTGVIAVGLGNLGGLVRNYGW*
Ga0126370_1209714513300010358Tropical Forest SoilMLEWKFRLVILLAVAGMIAAAFGNFGWHPLNFSW*
Ga0126376_1120099223300010359Tropical Forest SoilMLEWKFRLVILMAAAGMVAAAFGNFGWHPLNFSW*
Ga0126376_1270570723300010359Tropical Forest SoilMLEWKFRLVILLAVAGMIAAALGSLPGSHLNFGW*
Ga0126378_1189723023300010361Tropical Forest SoilMLEWKSRLLILLALAGVLAASSGLIGGLVHNFGW*
Ga0126377_1055794623300010362Tropical Forest SoilMLEWKFRLVILLAVAGMVAAAFGNFGWHPHNFGW*
Ga0126379_1365910123300010366Tropical Forest SoilFSPGGTMLEWKFRLVILLAAAGMVAAALGSGHGPHNFGW*
Ga0134122_1088947123300010400Terrestrial SoilMLEWKFRLVILLALAGVIAAGLGSLGGLVHNFGW*
Ga0134122_1163256623300010400Terrestrial SoilGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW*
Ga0137383_1060350123300012199Vadose Zone SoilMLEWKSRLVILLALAAMIAAALGNLGLSHINFGW*
Ga0137381_1103868923300012207Vadose Zone SoilMLEWKSRLVILLALAAMIAAALGNFDLSHINFGW*
Ga0137376_1014105413300012208Vadose Zone SoilMLEWKFRLVILLALAGVIAVCLGNFGGLVHNFGW*
Ga0150985_10451114223300012212Avena Fatua RhizosphereLTTFSPGGTMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW*
Ga0150985_11753534223300012212Avena Fatua RhizosphereMLEWKFRLVILLALAGVFAVGLGNFGGLVHNFGW*
Ga0137370_1003052723300012285Vadose Zone SoilMLEWKFRLVILLALTGVIAVGLGNLGGLVHNFGW*
Ga0150984_10490505213300012469Avena Fatua RhizosphereFSPGGTMLEWKFRLVILLALAGVIAVGLGSFGGLVHNFGW*
Ga0150984_10886789813300012469Avena Fatua RhizosphereLTTFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW*
Ga0157308_1031409613300012910SoilMLEWKFRLVILLAFAGMTAAALGNLGGLIHNFSW*
Ga0137413_1059048123300012924Vadose Zone SoilMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW*
Ga0164300_1010682613300012951SoilMLEWKFRLVILLALAGMTAAAFGNLGGLIHNFSW*
Ga0164300_1035971823300012951SoilMLEWKFRLVILLALAGVTAAALGNLGGLRHIYSR*
Ga0126369_1138463113300012971Tropical Forest SoilMLEWKFRLVILMAVAGMIAAAVGNLGWHPLNLGW*
Ga0126369_1278099423300012971Tropical Forest SoilMLEWKFRLVILLAVAAMVAAAFGNLGWQLLNLGW*
Ga0157370_1143005213300013104Corn RhizosphereMLEWKFRLVILLALAGTIATALGNLGWHSMNLGW*
Ga0157374_1293721623300013296Miscanthus RhizosphereMLEWKFRLVILLALAGVIAAGLGNRAGSLHVNFGW*
Ga0157372_1079617123300013307Corn RhizosphereMLEWKFRLVILMALAGVVAAGLGNLAGSLHINFGW*
Ga0120132_104329723300013832PermafrostMLEWKFRLVILLALACTVAVALGNLGWQPLNLGW*
Ga0132258_1071832023300015371Arabidopsis RhizosphereMLEWKFRLVILLALAGMTAAAVGSLGGLFHNFSW*
Ga0132258_1322333923300015371Arabidopsis RhizosphereGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW*
Ga0187809_1014192023300017937Freshwater SedimentMLEWKFRLVGLLAVAGIIAAASGDLLGSLVHHNFGW
Ga0247669_100517223300024182SoilMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW
Ga0247687_100952913300024286SoilMLEWKFRLVILMALAGVIAAGLGNLAGSLHINFGW
Ga0247690_101728013300024287SoilGGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW
Ga0247666_105473413300024323SoilPSGVLTTFSPGGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW
Ga0207663_1019451423300025916Corn, Switchgrass And Miscanthus RhizosphereLSGVPTTFSPGGTMLEWKFRLVILLALAGVLAVGLGNLGGLVHNFGW
Ga0207663_1074169213300025916Corn, Switchgrass And Miscanthus RhizospherePFREAAPTISESGVLDPTSPGGTMLEWKFRLVILLAVAGSVAAALGNLVTAHNFGW
Ga0207646_1117383213300025922Corn, Switchgrass And Miscanthus RhizosphereSLTTFSPGGTMLEWKFRLVILLALAGVIAAGLGNLAGSLHVNFGW
Ga0207694_1051081413300025924Corn RhizospherePGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW
Ga0207700_1058060323300025928Corn, Switchgrass And Miscanthus RhizosphereMLEWKSRLLILLSLAGILAASSGYIGGLVHINFGW
Ga0207664_1052261113300025929Agricultural SoilVPGGTMLEWKFRLVTLLAFAAVLAVALGSSVAGGALNFGW
Ga0207665_1058410023300025939Corn, Switchgrass And Miscanthus RhizosphereMLEWKFRLVILLALAGVIAVGLGNFGGLVHFNFGW
Ga0207661_1216895223300025944Corn RhizosphereGVLTTFSPGGTMLEWKFRLVILMALAGIVAAGLGNLAGSLHINFGW
Ga0207712_1186495323300025961Switchgrass RhizospherePTIPPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW
Ga0208142_101850913300025994Rice Paddy SoilTYSPGGKMLEWKFRLVILLAVAGMVAAALGNFGGQVFNFGW
Ga0307503_1044053423300028802SoilFSPGGTMLEWKFRLVILLALAGVIAVGLGSLGGLVHNFGW
Ga0318568_1021399413300031819SoilFSPGGKMLEWKFRLVILSALACTIAVALGNLGWHPGNLGW
Ga0308175_10305901323300031938SoilMLEWKFRLVILLAAAGVIAAAVGNLGCFLPLNFSW
Ga0308174_1000237433300031939SoilMLEWKFRLVVLLAVAGTVAAALGSLGCFLPLNFNW
Ga0318553_1071227813300032068SoilPGGTMLEWKFRLVILLALAATVAAAFGNLGWHCSNLGW
Ga0335069_1010692523300032893SoilMLEWKFRLVILLALAGVIAVGLGNFESLQHINFGW
Ga0247829_1118333513300033550SoilPSGVPTTYSPGGTMLEWKFRLVILLALAGMTAAALGNLGGLIHNFSW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.