NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071866

Metagenome / Metatranscriptome Family F071866

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071866
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 120 residues
Representative Sequence VSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDTNDSDAEPDEASDCEMFGT
Number of Associated Samples 77
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.21 %
% of genes near scaffold ends (potentially truncated) 38.02 %
% of genes from short scaffolds (< 2000 bps) 70.25 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(29.752 % of family members)
Environment Ontology (ENVO) Unclassified
(72.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(43.802 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.14%    β-sheet: 0.00%    Coil/Unstructured: 42.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF03975CheD 21.49
PF00072Response_reg 5.79
PF01339CheB_methylest 4.96
PF00474SSF 4.96
PF00929RNase_T 3.31
PF12860PAS_7 2.48
PF13545HTH_Crp_2 1.65
PF10335DUF294_C 1.65
PF07452CHRD 0.83
PF11752DUF3309 0.83
PF08281Sigma70_r4_2 0.83
PF00274Glycolytic 0.83
PF03705CheR_N 0.83
PF04542Sigma70_r2 0.83
PF00486Trans_reg_C 0.83
PF08439Peptidase_M3_N 0.83
PF02743dCache_1 0.83
PF00672HAMP 0.83
PF02518HATPase_c 0.83
PF03946Ribosomal_L11_N 0.83
PF14026DUF4242 0.83
PF00575S1 0.83
PF11755DUF3311 0.83
PF00015MCPsignal 0.83
PF00702Hydrolase 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG1871Chemotaxis receptor (MCP) glutamine deamidase CheDSignal transduction mechanisms [T] 42.98
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 9.92
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 1.65
COG1352Methylase of chemotaxis methyl-accepting proteinsSignal transduction mechanisms [T] 1.65
COG0080Ribosomal protein L11Translation, ribosomal structure and biogenesis [J] 0.83
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.83
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.83
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.83
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.83
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.83
COG3588Fructose-bisphosphate aldolase class 1Carbohydrate transport and metabolism [G] 0.83
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.17 %
UnclassifiedrootN/A0.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000313|WSSedB1CaDRAFT_10119386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.502Open in IMG/M
3300001213|JGIcombinedJ13530_100224278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.524Open in IMG/M
3300009621|Ga0116116_1176295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.553Open in IMG/M
3300009635|Ga0116117_1191105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.538Open in IMG/M
3300009644|Ga0116121_1187149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.657Open in IMG/M
3300009762|Ga0116130_1020819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2187Open in IMG/M
3300014158|Ga0181521_10584251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.525Open in IMG/M
3300014160|Ga0181517_10015189All Organisms → cellular organisms → Bacteria → Proteobacteria5611Open in IMG/M
3300014160|Ga0181517_10017972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae5014Open in IMG/M
3300014160|Ga0181517_10024017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4122Open in IMG/M
3300014160|Ga0181517_10266694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.910Open in IMG/M
3300014160|Ga0181517_10294762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.854Open in IMG/M
3300014161|Ga0181529_10003131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria19144Open in IMG/M
3300014161|Ga0181529_10006354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales12024Open in IMG/M
3300014161|Ga0181529_10016191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae6461Open in IMG/M
3300014161|Ga0181529_10031158All Organisms → cellular organisms → Bacteria → Proteobacteria4099Open in IMG/M
3300014161|Ga0181529_10202150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1164Open in IMG/M
3300014161|Ga0181529_10276533All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300014161|Ga0181529_10595102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.577Open in IMG/M
3300014167|Ga0181528_10503809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.666Open in IMG/M
3300014168|Ga0181534_10113420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1365Open in IMG/M
3300014168|Ga0181534_10364647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.792Open in IMG/M
3300014168|Ga0181534_10611683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.628Open in IMG/M
3300014169|Ga0181531_10333672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.929Open in IMG/M
3300014199|Ga0181535_10315242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.930Open in IMG/M
3300014200|Ga0181526_10557265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.725Open in IMG/M
3300014201|Ga0181537_10004697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11274Open in IMG/M
3300014201|Ga0181537_10143604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1635Open in IMG/M
3300014490|Ga0182010_10335558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.816Open in IMG/M
3300014490|Ga0182010_10751653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.551Open in IMG/M
3300014491|Ga0182014_10031203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4098Open in IMG/M
3300014491|Ga0182014_10346252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.752Open in IMG/M
3300014492|Ga0182013_10014435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7733Open in IMG/M
3300014492|Ga0182013_10264600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.986Open in IMG/M
3300014496|Ga0182011_10534552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.751Open in IMG/M
3300014496|Ga0182011_10939998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.537Open in IMG/M
3300014498|Ga0182019_10018912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.3732Open in IMG/M
3300014498|Ga0182019_10374714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales965Open in IMG/M
3300014502|Ga0182021_10340364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1772Open in IMG/M
3300014502|Ga0182021_10527211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1410Open in IMG/M
3300014638|Ga0181536_10392760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.622Open in IMG/M
3300014638|Ga0181536_10427901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.587Open in IMG/M
3300014654|Ga0181525_10236732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.996Open in IMG/M
3300014657|Ga0181522_10745256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.599Open in IMG/M
3300014658|Ga0181519_10591056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.684Open in IMG/M
3300014838|Ga0182030_10077539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4841Open in IMG/M
3300016701|Ga0181509_1131989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.523Open in IMG/M
3300016728|Ga0181500_1281127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.635Open in IMG/M
3300017938|Ga0187854_10470481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.523Open in IMG/M
3300017946|Ga0187879_10194287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1139Open in IMG/M
3300017948|Ga0187847_10007265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7708Open in IMG/M
3300017948|Ga0187847_10501212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.673Open in IMG/M
3300017988|Ga0181520_10004781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales22281Open in IMG/M
3300017988|Ga0181520_10010118All Organisms → cellular organisms → Bacteria → Proteobacteria12757Open in IMG/M
3300017988|Ga0181520_10037430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae4903Open in IMG/M
3300017988|Ga0181520_10046433All Organisms → cellular organisms → Bacteria → Proteobacteria4203Open in IMG/M
3300017988|Ga0181520_10273473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1279Open in IMG/M
3300017988|Ga0181520_10497477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.864Open in IMG/M
3300017988|Ga0181520_10748558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.663Open in IMG/M
3300017988|Ga0181520_11079890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.528Open in IMG/M
3300017988|Ga0181520_11080129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.528Open in IMG/M
3300018008|Ga0187888_1334223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.578Open in IMG/M
3300018035|Ga0187875_10367619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.771Open in IMG/M
3300018040|Ga0187862_10266075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1096Open in IMG/M
3300018040|Ga0187862_10662950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.613Open in IMG/M
3300018043|Ga0187887_10027300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3624Open in IMG/M
3300018046|Ga0187851_10373255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.819Open in IMG/M
3300018047|Ga0187859_10075076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1780Open in IMG/M
3300018088|Ga0187771_10957257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.726Open in IMG/M
3300018090|Ga0187770_10165609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1691Open in IMG/M
3300023090|Ga0224558_1159678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.715Open in IMG/M
3300023091|Ga0224559_1054867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1563Open in IMG/M
3300023091|Ga0224559_1133489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.895Open in IMG/M
3300026456|Ga0255351_1052317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.831Open in IMG/M
3300027905|Ga0209415_10970527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.569Open in IMG/M
3300028090|Ga0255349_1056843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.776Open in IMG/M
3300028745|Ga0302267_10289910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.698Open in IMG/M
3300028762|Ga0302202_10149317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1256Open in IMG/M
3300028765|Ga0302198_10296735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.762Open in IMG/M
3300028813|Ga0302157_10616286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.558Open in IMG/M
3300028867|Ga0302146_10139433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.981Open in IMG/M
3300029945|Ga0311330_10302378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1379Open in IMG/M
3300029945|Ga0311330_10973581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.629Open in IMG/M
3300029955|Ga0311342_10755413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.756Open in IMG/M
3300029957|Ga0265324_10089718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1046Open in IMG/M
3300030000|Ga0311337_10689760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.882Open in IMG/M
3300030225|Ga0302196_10130140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1366Open in IMG/M
3300031235|Ga0265330_10021442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2949Open in IMG/M
3300031235|Ga0265330_10027426All Organisms → cellular organisms → Bacteria → Proteobacteria2573Open in IMG/M
3300031235|Ga0265330_10061249All Organisms → cellular organisms → Bacteria → Proteobacteria1637Open in IMG/M
3300031241|Ga0265325_10081521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1608Open in IMG/M
3300031241|Ga0265325_10314007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.697Open in IMG/M
3300031247|Ga0265340_10224216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.842Open in IMG/M
3300031249|Ga0265339_10003084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11726Open in IMG/M
3300031344|Ga0265316_10064819All Organisms → cellular organisms → Bacteria → Proteobacteria2830Open in IMG/M
3300031344|Ga0265316_11210843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.522Open in IMG/M
3300031524|Ga0302320_10799070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1045Open in IMG/M
3300031595|Ga0265313_10155147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.976Open in IMG/M
3300031708|Ga0310686_104449218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4555Open in IMG/M
3300031711|Ga0265314_10141418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1487Open in IMG/M
3300031711|Ga0265314_10281452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.941Open in IMG/M
3300031712|Ga0265342_10095203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1703Open in IMG/M
3300032560|Ga0316223_1161552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.739Open in IMG/M
3300032668|Ga0316230_1188204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.740Open in IMG/M
3300032829|Ga0335070_10109557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2875Open in IMG/M
3300032829|Ga0335070_10614058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1022Open in IMG/M
3300032893|Ga0335069_10025995All Organisms → cellular organisms → Bacteria → Proteobacteria8012Open in IMG/M
3300032893|Ga0335069_10246902All Organisms → cellular organisms → Bacteria → Proteobacteria2149Open in IMG/M
3300033402|Ga0326728_10030646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9116Open in IMG/M
3300033402|Ga0326728_10031725All Organisms → cellular organisms → Bacteria → Proteobacteria8859Open in IMG/M
3300033402|Ga0326728_10061768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5175Open in IMG/M
3300033405|Ga0326727_10055724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6076Open in IMG/M
3300033405|Ga0326727_11143819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.549Open in IMG/M
3300033755|Ga0371489_0000199All Organisms → cellular organisms → Bacteria → Proteobacteria119421Open in IMG/M
3300033755|Ga0371489_0016890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6141Open in IMG/M
3300033755|Ga0371489_0031462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3922Open in IMG/M
3300033827|Ga0334848_021571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1320Open in IMG/M
3300033982|Ga0371487_0059466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2175Open in IMG/M
3300033983|Ga0371488_0259140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.848Open in IMG/M
3300034124|Ga0370483_0348546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.513Open in IMG/M
3300034282|Ga0370492_0001887Not Available8291Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog29.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere11.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog8.26%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil8.26%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.61%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog4.13%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.65%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland1.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.83%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000313Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 CattailEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300032560Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009EnvironmentalOpen in IMG/M
3300032668Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033827Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
WSSedB1CaDRAFT_1011938623300000313WetlandVSQPDSPPLSPISETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLASRQVSDPETGVEEASDCEMFGT
JGIcombinedJ13530_10022427813300001213WetlandMRPVSQPDSPPLSPISETLRRVTDELRKVTRRLEKVDDAVGRLVFEAAANKGAQFRDLQDLDRARQEVAGIAGFLERLAHDMPAEWVADSTNATLLIDLHELAASLAQRDASENGTSGDRADDCEMFV*
Ga0116116_117629513300009621PeatlandVTDELRKVTRRLEKVDDAVGRLVFESASPRAPQFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLLIDLHELAASLARPDCSDPDAGAEEASDCEMFGT*
Ga0116117_119110513300009635PeatlandVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDTNDSDAEPDEASDCEMFGT*
Ga0116121_118714913300009644PeatlandPIGETLRRVTEELRKVTLRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLQELASSLAKPEANDSDSGPDEASDCEMFGT*
Ga0116130_102081913300009762PeatlandVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEIAGIAGFLERLARDMPAEWVADTNTASLLIDLHELAASLAQREANDSDSGPE
Ga0181521_1058425113300014158BogLSQPDSPPLSPIGETLRRVTEELRKVTRRLERVDNAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLQELASSLAKPEASESDSGPDEASDSEMFGA*
Ga0181517_1001518933300014160BogVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLAKRNTNDSDAEPDEASDCEMFGT*
Ga0181517_1001797223300014160BogVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHDLASSLAMRDADESDAEPGEASDCEMFGT*
Ga0181517_1002401743300014160BogVSQPDSPPLSPIGETLRRVTNELRKVTRRLERVDNAVGRLVFDAASPKGAHFHDLQDLDRAKQEVTGIASFLERLARDMPTEWVADSSTASLLIDLHELAASLAERDAGEPDAQPEKASDCEMFRT*
Ga0181517_1026669423300014160BogVSQPNSPPLSPIGETLRRVTDELRKVARRLERVDDAVGRLVFDAATVKGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPADWVADSRNASLLIDLHELAASLARREANESDAGPDGASDCEMFGT*
Ga0181517_1029476223300014160BogLSPIGATLQRVTEELHHVTHRLEKVDDAVGRLVFESARPAASYFHDLQDLDRARQEIVGIARFLERLARDMPAEWLADSKSASLLIDLQELASNLARHEARDCEKAQPAAHECEMF*
Ga0181529_10003131133300014161BogVSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLAKRDAGDTDAAPDEASDCEMFGT*
Ga0181529_1000635483300014161BogLSPIGATLQRVTEELHHVTHRLEKVDDAVGRLVFESARPAASYFHDLQDLDRARQEIVGIARFLERLARDMPAEWLADSKSASLLIDLQELASSLARHEARDSEKTQPAAHECEMF*
Ga0181529_1001619183300014161BogVSQSVSPPLSPIGETLRRVTDELRKVTRRLEKVDNAVGRLVFDSATPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHELATSLAHSNAHESDVESDDASDCEMFGT*
Ga0181529_1003115813300014161BogVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLAKRNTNDSGAEPDEASDCEMFGT*
Ga0181529_1020215033300014161BogVSQTDSPPLSPIGETLRRVTDELRKVTRRLERVENAVGRLVFEAASPKGTHFHDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSKTASLLIDLQELAASLAHREAHDPDVD
Ga0181529_1027653323300014161BogVKQSRKPALSPIGATLQRVTEELQRVTHRLEKVDDAVGRLVFESASPAGSYFHDLQDLDRARQEIAGIACFLERLARDMPEEWLADSKSVSLLIDLQELASSLARHEARDSEKAQSAAHECEMF*
Ga0181529_1059510223300014161BogVSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHDLAASLAMRDADESDAEPGDTSDCEMFGT*
Ga0181528_1050380913300014167BogVSQPNSPPLSPIGETLRRVTDELRKVARRLERVDDAVGPLVFDAATVKGTHFHDLQDLDRAKQEVAGIAGFLERLARDMPTEWVADSRNASLLIDLHELASSLARREANESDAEPDGASDCEMFGT*
Ga0181534_1011342043300014168BogVSQPNSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHDLAASLAMRDADESDAE
Ga0181534_1036464723300014168BogVSKSETPRLFPIGETLRRVTDELRKVSQRLEKVDEAVGRMVFDSASAGGAQFHDLQDLDRAQQEVAAIAGFLERLARDMPSEWVADSRTASLTIDLHELAVSLARREAKDGVGARRADGDCEMFS*
Ga0181534_1061168323300014168BogVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFDAASPRGPHFHDLQDLDRAKQEVAGIAGFLERLAHDMPVEWVADSNTATLMIDLHELATSLAKRDVDGSDAGPDEASDCEMFGA*
Ga0181531_1033367223300014169BogVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFDAASPRGPHFHDLQDLDRAKQEVAGIAGFLERLAHDMPVEWVADSNTATLMIDLHELATSLAKRDVDGSDAGPDEASDCEMFGT*
Ga0181535_1031524223300014199BogVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDDAVGRLVFDAASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLIIDLHELAASLAQPEANDSDVGPGGASDCEMFA*
Ga0181526_1055726513300014200BogVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLAKRDTNDSDAEPDEASDCEMFGT*
Ga0181537_10004697123300014201BogVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPADWVADSRNASLLIDLHELASSLARREANESDAEPDGASDCEMFGT*
Ga0181537_1014360423300014201BogVTDELRKVTRRLERVDDAVGKLVFDAAMPKGSHFHDLQDLDRAKQEVAGIAGFLERLAHDMPVEWVADSNTASLLIDLHELASSLAKREGSDSDAGADDANDCEMFGT*
Ga0182010_1033555813300014490FenMSQPEGPPLSPIGETLRRVTNELRKVTGRLERVDDAVGRLVFDSASRSAQFRDLQDLDRAKQEVAGIAGFLERLAHNMPSEWVADSNTASLMIDLHELANSLARHDACDGEISPGGADDCEMFV*
Ga0182010_1075165323300014490FenVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLMIDLHELAASLARRDAHDPDAEPGDAS
Ga0182014_1003120323300014491BogVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAKRDGSDSETGVEEASDCEMFGT*
Ga0182014_1034625213300014491BogVSQPGSPPFSPIGETLRRVTNELRKVTRRLETVDDAVGRLVFESASRSAQFRDLQDLDRAKQEVAGIAGFLERLAHDMPSEWVADSNTASLMIDLHELANSLARHDACDGEISHGGADDCEMFV*
Ga0182013_1001443513300014492BogVSQSANHPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFETASPRTPQFRDLQDLDRARQEVAGIAHFLERLSRDMPSEWVADSNNASLLIDLQELATSLARSDPTDADPERAGPSDCEMFS*
Ga0182013_1026460023300014492BogVTDELRKVTHRLERVDDAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLIIDLHELAASLAKPEVTDSDAGPGGANDCEMFA*
Ga0182011_1053455213300014496FenVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAHADAHESETAAGGTSDCDMFA*
Ga0182011_1093999813300014496FenMSQPGGPPFSPIGETLRRVTNELRKVTRRLETVDDAVGRLVFESASRSAQFRDLQDLDRAKQEVAGIAGFLERLAHDMPSEWVADSNTASLMIDLHELATSLAKNEMCGGKTSHGGDDDCEMFV*
Ga0182019_1001891233300014498FenMSQPGGPPFSPIGETLRRVTNELRKVTRRLETVDDAVGRLVFESASRSAQFRDLQDLDRAKQEVAGIAGFLERLAHDMPSEWVADSNTASLMIDLHELASSLAKNEMCDGET
Ga0182019_1037471423300014498FenVSQPDSPPLSPIGETLRRVTDELRKVTQRLERVDDAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAHADAHESETAAGGTSDCDMFA*
Ga0182021_1034036443300014502FenVSQPDSHPLSPIGETLRRVTDELRKVTLRLERVDDAVGRLVFDAASPRGPHFHDLQDLDRAKQEVSGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAHADAHESETAAGGTSDCDMFA*
Ga0182021_1052721123300014502FenVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAKRDGSDSETGVEEASDCEMFGT*
Ga0181536_1039276023300014638BogGETLRRVTEELRKVTRRLERVDNAVGRLVFDAASVKGTHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSSNASLLIDLHELALSLAQREANDSDSGPDEASDCEMFGT*
Ga0181536_1042790113300014638BogRFPPIGETLRRVTDELRKVTRQQEKVDDAVGRLVFESASRNAQFRDLQDLDRAKQEVAGIAGFLERLACDMLAEWFADSNTATLPIDLHELSTSLAHREARESERARSERDDCELFA*
Ga0181525_1023673223300014654BogVSQPNSPPLSPIGETLRRVTDELRKVARRLERVDDAVGRLVFDAATVKGTHFHDLQDLDRAKQEVAGIAGFLERLARDMPTEWVADSRNASLLIDLHELASSLARREANESDAEPDGASDCEMFGT*
Ga0181522_1074525613300014657BogVSQPNSPPLSPIGETLRRVTDELRKVARRLERVDDAVGRLVFDAATVKGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPADWVADSRNASLLIDLHELAASLARREANESDAGPDGASDCEMFGT
Ga0181519_1059105623300014658BogVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLAKR
Ga0182030_1007753973300014838BogVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDDAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLIIDLHELAASLAKPEVTDSDAGPGGANDCEMFA*
Ga0181509_113198913300016701PeatlandPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHDLASSLAMRDADESDAEPGEASDCEMFGT
Ga0181500_128112723300016728PeatlandVSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHDLASSLAMRDADES
Ga0187854_1047048123300017938PeatlandVAQSESPPLSPIGETLRRVTDELRKVTRRLEKVDDAVGRLVFESASPRAPQFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDMQELASSLAKREANDSDSGP
Ga0187879_1019428723300017946PeatlandVSQPDSPPLSPIGETLRRVTEELRKVTLRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLQELASSLAKPEANDSDSGPDEASDCEMFGT
Ga0187847_1000726523300017948PeatlandVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDTNDSDAEPDEASDCEMFGT
Ga0187847_1050121223300017948PeatlandVSQPNSPPLSPIGETLRRVTDELRKVARRLERVDDAVGRLVFDAATVKGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPADWVADSRNASLLIDLHELAASLARREAN
Ga0181520_10004781163300017988BogVRKSRKPALSPIGATLQRVTEELHHVTHRLEKVDDAVGRLVFESARPAASYFHDLQDLDRARQEIVGIARFLERLARDMPAEWLADSKSASLLIDLQELASSLARHEARDSEKTQPAAHECEMF
Ga0181520_10010118103300017988BogVSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLAKRDAGDTDAAPDEASDCEMFGT
Ga0181520_1003743023300017988BogVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHDLASSLAMRDADESDAEPGEASDCEMFGT
Ga0181520_1004643333300017988BogVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLAKRNTNDSGAEPDEASDCEMFGT
Ga0181520_1027347323300017988BogVSQSVSPPLSPIGETLRRVTDELRKVTRRLEKVDNAVGRLVFDSATPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHELATSLAHSNAHESEAGSDDTSDCEMFGT
Ga0181520_1049747723300017988BogVSQTDSPPLSPIGETLRRVTDELRKVTRRLERVENAVGRLVFEAASPKGTHFHDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSKTASLLIDLQELAASLAHREAHDPDVDPGEASDCEMFGT
Ga0181520_1074855823300017988BogVKQSRKPALSPIGATLQRVTEELQRVTHRLEKVDDAVGRLVFESASPAGSYFHDLQDLDRARQEIAGIACFLERLARDMPEEWLADSKSASLLIDLQELASSLARHEARDSEKAQSAAHECEMF
Ga0181520_1107989013300017988BogVSQPDSPPLSPIGETLRRVTEELRKVTLRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVSGIAGFLERLARDMPVEWVADSNTATLLIDLHELALSLAKGDADDSDAGPGEASDCEMFGT
Ga0181520_1108012913300017988BogLRKVTRRLERVDNAVGRLVFDAASPRGPHFHDLQDLDRAKQEVSGIAGFLERLARDMPAEWVADSNTATLLIDLHELASSLATHGADDSDAEPDGASDCEMFGA
Ga0187888_133422323300018008PeatlandVSQPDSPPLSPIGETLRRVTEELRKVTLRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLHELAASLAKRDTNDSDAEP
Ga0187875_1036761913300018035PeatlandPSRVSEDASVSQPDSPPLSPIGETLRRVTEELRKVTLRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLLIDLQELASSLAKPEANDSDSGPDEASDCEMFGT
Ga0187862_1026607523300018040PeatlandVSQPDSPPLSPIGETLRRVTEELRKVTRRLERVDNAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLQELASSLAKPEASESDSGPDEASDSEMFGA
Ga0187862_1066295013300018040PeatlandETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEIAGIAGFLERLARDMPAEWVADSNTATLLIDLQELASSLAKPEANDSDSGPDEASDCEMFGT
Ga0187887_1002730023300018043PeatlandVSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDTNDSDAEPDEASDCEMFGT
Ga0187851_1037325513300018046PeatlandVSQSDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPRGKHFHDLQDLDRAKQEVSGIAGFLERLARDMPAEWVADSNTATLLIDLHDLAASLAKPDANDSDAEPGQASDCEMFGT
Ga0187859_1007507613300018047PeatlandETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDTNDSDAEPDEASDCEMFGT
Ga0187771_1095725723300018088Tropical PeatlandRRVTEELRKVAQRLARVDDAVGRLVFESASPNGAYFRDLQDLDRARQEIAGIARFLERLASDMPGDWLADSKSASLFIDLHELASSLARHEAVDDKAAQGGADDCEML
Ga0187770_1016560923300018090Tropical PeatlandVKKSKKLLLSPIGATLRRVTEELRKVAQRLARVDDAVGRLVFESASPNGAYFRDLQDLDRARQEIAGIARFLERLASDMPGDWLADSKSASLFIDLHELASSLARHEAVDDKAAQGGADDCEML
Ga0224558_115967823300023090SoilSEDASVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAKRDGSDSETGVEEASDCEMFGT
Ga0224559_105486733300023091SoilVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELAASLAKRDGSDSETGVEEASDCEMFGT
Ga0224559_113348923300023091SoilVSQPDSHPLSPIGETLRRVTDELRKVTQRLERVDDAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLIIDLHELAASLAKPEANDPAAGPGGPNDCEMFA
Ga0255351_105231723300026456SoilSVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLMIDLHELAASLARRDTNEFDAEPDEASDCEMFGA
Ga0209415_1097052713300027905Peatlands SoilVSQPDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLAHRDAHDPDAESGEASDCEMFGT
Ga0255349_105684313300028090SoilSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLMIDLHELAASLARRDTNEFDAEPDEASDCEMFGA
Ga0302267_1028991013300028745BogRKVARRLDRVDNAVGRLVFDAASPRGSQFHDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADTNTASLLIDLHELAASLAKRDVDDPEAGPEEASDCEMFGT
Ga0302202_1014931713300028762BogRKVARRLDRVDNAVGRLVFDAASPRGSQFHDLQDLDRAKQEVTGIAGFLERLAHDMPAEWVADTNTASLLIDLHELAASLAKRDVDDPEAGPEEASDCEMFGT
Ga0302198_1029673513300028765BogVSQPDSPPLSPIGETLRRVTDELRKVARRLDRVDNAVGRLVFDAASPRGSQFHDLQDLDRAKQEVTGIAGFLERLAHDMPAEWVADTNTASLLIDLHELAASLAKRDVDDPEAGPEEASDCEMFGT
Ga0302157_1061628613300028813BogGETLRRVTDELRKVTRRLERVDDAVGRLVFETASPRTPQFRDLQDLDRARQEVAGIAHFLERLSRDMPSEWVADSNNASLLIDLQELATSLARSDPTDADPERAGPSDCEMFS
Ga0302146_1013943323300028867BogVSQSANHPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFETASPRTPQFRDLQDLDRARQEVAGIAHFLERLSRDMPSEWVADSNNASLLIDLQELATSLARSDPTDADPERAGPSDCEM
Ga0311330_1030237843300029945BogARRLDRVDNAVGRLVFDAASPRGSQFHDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADTNTASLLIDLHELAASLAKRDVDDPEAGPEEASDCEMFGT
Ga0311330_1097358113300029945BogVSQLDSPPLSPIGETLRRVTDELRKVTRRLERVDNAVGRLVFDAASPKGPHFHDLQDLDRAKQEVAGIASFLERLARDMPTEWVADSSTASLLIDLHELAASLAERD
Ga0311342_1075541323300029955BogVSQSANHPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFETASPRTPQFRDLQDLDRARQEVAGIAHFLERLSRDMPSEWVADSNNASLLIDLQELATSLARS
Ga0265324_1008971813300029957RhizosphereVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLLIDLHELAASLAAKRGGSDSETGVEEASDC
Ga0311337_1068976023300030000FenVSQPDSHPLSPIGETLRRVTDELRKVTHRLERVDDAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLMIDLHELAASLAKRDAGDSDSSPNEASDCEMFGT
Ga0302196_1013014033300030225BogVSQPDSPPLSPIGETLRRVTDELRKVARRLDRVDNAVGRLVFDAASPRGSQFHDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADTNTASLLIDLHELAASLAKRDVDDPEAGPEEASDCEMFGT
Ga0265330_1002144243300031235RhizosphereVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLATRDGSDSDAGPEEASDCEMFGT
Ga0265330_1002742613300031235RhizosphereVSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLLIDLHELAASLAAKRGGSDSETGVEEASDCEMFGT
Ga0265330_1006124923300031235RhizosphereVSQSDSPPLSPIGETLRRVTDELRKITHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLMIDLHELAASLAHRDAHDADAAPDEASDCEMFGT
Ga0265325_1008152123300031241RhizosphereVSQPISPPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFDSAAVKGSHFHDLQDLDRAKQEVSGIAGFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDASDPNAESDSGSDCEMFGT
Ga0265325_1031400713300031241RhizosphereETLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLTHRDAHDADAEPGEASDCEMFGT
Ga0265340_1022421623300031247RhizosphereVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLTHRDAHDADAEPGEASDCEMFGT
Ga0265339_1000308473300031249RhizosphereVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLLIDLHELAASLAAKRGGSDSETGVEEASDCEMFGT
Ga0265316_1006481913300031344RhizosphereHRLERVDDAVGRLVFDAASPRGAHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELATSLAHRDASEGDGSAIGGDECEMFA
Ga0265316_1121084323300031344RhizosphereLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLMIDLHELAASLARRDAHDPDAEPGDASDCEMFGT
Ga0302320_1079907023300031524BogVSQPDSPPLSPIGETLRRVTNELRKVTRRLERVDNAVGRLVFDAASPKGAHFHDLQDLDRAKQEVTGIASFLERLARDMPTEWVADSSTASLLIDLHELAASLAERDAGEPDAQPEKASDCEMFRT
Ga0265313_1015514713300031595RhizosphereVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGRLVFDSASPRGPHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTATLMIDLHELAASLATRDGSDS
Ga0310686_10444921853300031708SoilVSKFEIPPLSPISETLRRVADELRKVTRRLEKVDEAVGRMVFESASINGGAQFSDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSRTASLVIDLHELATSLAQRDAKESERAQGEGDDCEMFG
Ga0265314_1014141813300031711RhizosphereVSHPDSPPLSPIGETLRRVTDELRKVTRRLEKVDDAVGRLVFESAANKGAQFRDLQDLDRARQEVSGIAGFLERLAHDMPSEWVADSTTATLLIDLHELAASLAQRDASEGEGSAGGGDECEMFV
Ga0265314_1028145223300031711RhizosphereVSQPISPPLSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFDSAAVKGSHFHDLQDLDRAKQEVSGIAGFLERLARDMPAEWVADSNTATLLIDLHELAASLARRDASDPNAESD
Ga0265342_1009520313300031712RhizosphereVSQPVSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLLIDLHELAASLAAKRGGSDSETGVEEASDCEMFGT
Ga0316223_116155213300032560FreshwaterVSQPDSPPLSPIGETLRRVTDELRKVTHRLERVDNAVGKLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTASLLIDLHELAASLAAKRGGSDSETG
Ga0316230_118820413300032668FreshwaterVSHPNSPPLSPISETLCRVTEELRKVTRRLERVDDAVGKLVFDSATSQGSQFRDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADSNTATLLIDLHELAASLAKRDGSDSDAGPEEASDCEMFGT
Ga0335070_1010955723300032829SoilVSQPDIPPLSPISETLRRVTEELRKVTNRLERVDDAVGRLVFETVGNKGAQFRDLQDLDRAKQEVAGIAGFLERLAHDMPTEWVADSRTASLLIDLHELAASLAQREEAEGDVSRNDTDDCEMFS
Ga0335070_1061405833300032829SoilVSQPDSPPLSPIGETLRRVTDELRKVTHRLEKVDDAVGRLVFEAASPRSGHFRDLQDLDRARQEVAGIAHFLERLSRDMPAEWVADSNTASLLIDLQELATSLARREAGESDPERG
Ga0335069_1002599543300032893SoilVSQPDSPPLSPIGETLRRVTDELRKVTHRLEKVDDAVGRLVFEAASPRSGHFRDLQDLDRARQEVAGIAHFLERLSRDMPAEWVADSNTASLLIDLQELATSLARREAGESDPERGGSDDCDMFV
Ga0335069_1024690223300032893SoilVSQPESPPLSPIGETLRRVTDELRKVTQRLERVDDAVGRLVFEAASPRSAHFRQLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSRTASLLIDLHELAANLARREAADPAAGPVDEDDCEMFA
Ga0326728_1003064673300033402Peat SoilVKQSRKPALSPIGATLQRVTEELHRVTHRLEKVDDAVGRLVFESASPARSYFHDLQDLDRARQEIAGIASFLERLAREMPEEWLADSKSASLLIDLQELASSLARHEARDSEKAQSAAHECEMF
Ga0326728_10031725103300033402Peat SoilVTQSESPPLSPIGETLRRVTDELRKVTRRLEKVDNAVGRLVFDAASVKGTHFHDLQDLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLHELASSLAHSDAHDSDAESGGASDCEMFA
Ga0326728_1006176843300033402Peat SoilVSQPDSPPLSPIGETLRRVTDELRKVTARLERVDDAVGRLVFDSASRNGAHLRDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSKTASLLIDLQELASSLARHEAGVSDDGPGGESDCEMFA
Ga0326727_1005572453300033405Peat SoilVSQPDSPPLSPIGETLRRVTDELRKVTARLERVDDAVGRLVFDSASRNGAHLRDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSKTASLLIDLQELASSLAKHEASDSDNGPGGESDCEMFA
Ga0326727_1114381923300033405Peat SoilVSQPDSPPLSPIGETLRRVTDELRKVTLRLERVDDAVGRLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADTNTASLLIDLHELAASLASRNADDSNAGRDESSD
Ga0371489_0000199_40853_412033300033755Peat SoilLSPIGATLQRVTEELHHVTHRLEKVDDAVGRLVFESARPAASYFHDLQDLDRARQEIVGIARFLERLARDMPAEWLADSKSASLLIDLQELASSLARHEARDSEKTQPAAHECEMF
Ga0371489_0016890_2587_29103300033755Peat SoilVTDELRKVTRRLDKVDDAVGRLVFESASPRAPQFNDLQNLDRAKQEVAGIAGFLERLARDMPAEWVADSNTASLLIDLDELATSLAHSDAHESETESGGASDCDLFA
Ga0371489_0031462_2418_27983300033755Peat SoilVSQPDSPPLSPIGETLRRVTDELRKVTLRLERVDDAVGRLVFDAASPRGSHFHDLQDLDRAKQEVAGIAGFLERLARDMPVEWVADTNTASLLIDLHELAASLASRNADDSNAGRDESSDYEMFGT
Ga0334848_021571_691_10653300033827SoilMSQPGGPPFSPIGETLRRVTNELRKVTRRLETVDDAVGRLVFESASRSAQFRDLQDLDRAKQEVAGIAGFLERLAHDMPSEWVADSNTASLMIDLHELANSLARHDACDGEISHGGADDCEMFV
Ga0371487_0059466_1_3183300033982Peat SoilVKQSRKPALSPIGATLQRVTEELHRVTHRLEKVDDAVGRLVFESASPARSYFHDLQDLDRARQEIAGIASFLERLAREMPEEWLADSKSASLLIDLQELASSLARH
Ga0371488_0259140_498_8483300033983Peat SoilSPIGETLRRVTDELRKVTRRLERVDDAVGRLVFDAASPRGSHFHELQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSNTATLLIDLHELAASLAKSEPGGPDAGPEEASDCEMFG
Ga0370483_0348546_93_4793300034124Untreated Peat SoilMRPVSKSETPRLSPIGETLRRVSDELRKVSRRLEKVDEAVGRMVFDSVSAGGAQFHDLQDLDRAKQEVAGIAGFLERLADDMPAEWVADSRTASLMIDLHELATSLARREANEVAGALGAGDDCEMFV
Ga0370492_0001887_7822_82023300034282Untreated Peat SoilVSQTKSPPLSPIGETLRRVTDELRKVTARLERVDDAVGRLVFEAASPMALQFRDLQDLDRAKQEVAGIAGFLERLAHDMPAEWVADSKTASLLIDLQELASSLARRDAHESDAGPGGASDCEMFAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.