NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072664

Metagenome / Metatranscriptome Family F072664

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072664
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 43 residues
Representative Sequence MTAKVLAALRSWKFQPAMRGDQPVEVTAILGFGIDTNDRF
Number of Associated Samples 107
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.83 %
% of genes near scaffold ends (potentially truncated) 97.52 %
% of genes from short scaffolds (< 2000 bps) 85.95 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(8.264 % of family members)
Environment Ontology (ENVO) Unclassified
(18.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.719 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.71%    β-sheet: 8.82%    Coil/Unstructured: 76.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF13682CZB 19.83
PF13088BNR_2 6.61
PF08281Sigma70_r4_2 4.13
PF07859Abhydrolase_3 2.48
PF05977MFS_3 1.65
PF028262-Hacid_dh_C 1.65
PF09413DUF2007 1.65
PF00324AA_permease 1.65
PF13520AA_permease_2 1.65
PF00326Peptidase_S9 1.65
PF00106adh_short 0.83
PF04365BrnT_toxin 0.83
PF01040UbiA 0.83
PF03544TonB_C 0.83
PF12811BaxI_1 0.83
PF14522Cytochrome_C7 0.83
PF07731Cu-oxidase_2 0.83
PF02517Rce1-like 0.83
PF00069Pkinase 0.83
PF12704MacB_PCD 0.83
PF02012BNR 0.83
PF12710HAD 0.83
PF01968Hydantoinase_A 0.83
PF01179Cu_amine_oxid 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.31
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 2.48
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 1.65
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 1.65
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 1.65
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 1.65
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 1.65
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.83
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.83
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.83
COG3733Cu2+-containing amine oxidaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.83
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.83
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_103841087All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1010582All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300002245|JGIcombinedJ26739_100985047All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300004081|Ga0063454_100007579All Organisms → cellular organisms → Bacteria2682Open in IMG/M
3300004081|Ga0063454_100450702All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300004091|Ga0062387_100028036All Organisms → cellular organisms → Bacteria2442Open in IMG/M
3300004091|Ga0062387_100255210All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300004104|Ga0058891_1568696All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300004152|Ga0062386_100118180All Organisms → cellular organisms → Bacteria2048Open in IMG/M
3300004479|Ga0062595_100496247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068915Open in IMG/M
3300005177|Ga0066690_10380212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300005434|Ga0070709_10369876All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300005434|Ga0070709_11708133All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005436|Ga0070713_100959297All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300005468|Ga0070707_102273654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300005541|Ga0070733_10223795All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300005542|Ga0070732_10193476All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300005542|Ga0070732_10824895All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005553|Ga0066695_10375098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium887Open in IMG/M
3300005578|Ga0068854_102145592All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005591|Ga0070761_10260148All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300005602|Ga0070762_10080210All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300005712|Ga0070764_10050965All Organisms → cellular organisms → Bacteria2123Open in IMG/M
3300005888|Ga0075289_1014202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1093Open in IMG/M
3300005952|Ga0080026_10015039All Organisms → cellular organisms → Bacteria1841Open in IMG/M
3300006057|Ga0075026_100980517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300006059|Ga0075017_100782344All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300006162|Ga0075030_100957043All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300006162|Ga0075030_101410215All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006173|Ga0070716_100857995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae707Open in IMG/M
3300006174|Ga0075014_100115358All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300006176|Ga0070765_102168089All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300009088|Ga0099830_10830980All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300009646|Ga0116132_1211417All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300009839|Ga0116223_10511335All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300010337|Ga0134062_10237163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae844Open in IMG/M
3300010341|Ga0074045_10647813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300010358|Ga0126370_10612202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345942Open in IMG/M
3300010358|Ga0126370_10821918All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300010371|Ga0134125_11728558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300010379|Ga0136449_100463463All Organisms → cellular organisms → Bacteria2217Open in IMG/M
3300010379|Ga0136449_103087283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300010398|Ga0126383_10064865All Organisms → cellular organisms → Bacteria3112Open in IMG/M
3300010400|Ga0134122_10311076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1356Open in IMG/M
3300011119|Ga0105246_11325583All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300012930|Ga0137407_11528048All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300013308|Ga0157375_10206056All Organisms → cellular organisms → Bacteria → Acidobacteria2123Open in IMG/M
3300014969|Ga0157376_11936766All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300015241|Ga0137418_10479249All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300015371|Ga0132258_10837082All Organisms → cellular organisms → Bacteria2321Open in IMG/M
3300016270|Ga0182036_11636342All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300016404|Ga0182037_10434745All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300017823|Ga0187818_10091252All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300017955|Ga0187817_10805662All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300017955|Ga0187817_11075283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300017961|Ga0187778_11001599All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300017970|Ga0187783_10099440All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300017972|Ga0187781_10030686All Organisms → cellular organisms → Bacteria3714Open in IMG/M
3300017993|Ga0187823_10228924All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300018006|Ga0187804_10006768All Organisms → cellular organisms → Bacteria3775Open in IMG/M
3300018012|Ga0187810_10189035All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300018062|Ga0187784_10890984All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300018085|Ga0187772_10153124All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300018085|Ga0187772_10553569All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300018088|Ga0187771_11285880All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300018468|Ga0066662_10017079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3964Open in IMG/M
3300019786|Ga0182025_1111617All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300021046|Ga0215015_10258746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300021171|Ga0210405_10833818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300021407|Ga0210383_10551904All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300021559|Ga0210409_10598959All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300021860|Ga0213851_1438589All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300025457|Ga0208850_1068150All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300025945|Ga0207679_10922947All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300026035|Ga0207703_10452554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1199Open in IMG/M
3300026309|Ga0209055_1095843All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300026550|Ga0209474_10302774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus940Open in IMG/M
3300027035|Ga0207776_1022036All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300027783|Ga0209448_10161575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300027825|Ga0209039_10413028All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027842|Ga0209580_10296847All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300027842|Ga0209580_10453090All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027842|Ga0209580_10597026All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300027867|Ga0209167_10053908All Organisms → cellular organisms → Bacteria1981Open in IMG/M
3300027867|Ga0209167_10574470All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300027869|Ga0209579_10072070All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300027884|Ga0209275_10072461All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300027911|Ga0209698_10503576All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300027911|Ga0209698_10977696All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300028792|Ga0307504_10132368All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300028795|Ga0302227_10081260All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300029636|Ga0222749_10009089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4003Open in IMG/M
3300029923|Ga0311347_10724700All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300030007|Ga0311338_10594398All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300030057|Ga0302176_10094569All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300030524|Ga0311357_11841825All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031057|Ga0170834_106411036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300031231|Ga0170824_120784145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300031233|Ga0302307_10426214All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031446|Ga0170820_13166338All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300031469|Ga0170819_17632213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031711|Ga0265314_10612174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300031718|Ga0307474_10115899All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300031754|Ga0307475_10867554All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031954|Ga0306926_10771943All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300031996|Ga0308176_11774525All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300032076|Ga0306924_10539282All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300032174|Ga0307470_10167047All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300032180|Ga0307471_102004930All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300032770|Ga0335085_10367699All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300032783|Ga0335079_10069195All Organisms → cellular organisms → Bacteria4021Open in IMG/M
3300032805|Ga0335078_10137690All Organisms → cellular organisms → Bacteria3471Open in IMG/M
3300032828|Ga0335080_10343098All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300032828|Ga0335080_10767179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300032829|Ga0335070_10369271All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300032892|Ga0335081_10921436All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300032954|Ga0335083_10102612All Organisms → cellular organisms → Bacteria2813Open in IMG/M
3300033004|Ga0335084_11570439All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300033158|Ga0335077_11468150All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300034125|Ga0370484_0072275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium878Open in IMG/M
3300034163|Ga0370515_0235734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.26%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil7.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.13%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.13%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.31%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.65%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.83%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.83%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.83%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.83%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10384108723300000364SoilILAALRNWKFQPAMRNNQPVAVTAILGFGIDTNDRF*
AP72_2010_repI_A10DRAFT_101058223300000651Forest SoilPAQMTAKVVAALRNWKFQPAMRNSQPVEVTAILGFGIDTNDRF*
JGIcombinedJ26739_10098504713300002245Forest SoilKNPRVLEAGPAEFTVKILAALRSWKFQPATRGNQPVEVTAILGFGIDTNDRF*
Ga0063454_10000757933300004081SoilVLEAGSAQMTAKVLASLRAWKFQPAMRGKQPVEVTAILGFGIDTNDRF*
Ga0063454_10045070213300004081SoilPAAMTAKVLSALRSWKFQPAMRNDQPVDVTAILGFGVNTDDRF*
Ga0062387_10002803643300004091Bog Forest SoilLEAGPADMTAKVLIALRAWKFQPAILGNDPVEVTAILGFGVDTNDRF*
Ga0062387_10025521023300004091Bog Forest SoilNVRVLEPGPAEMTAKIIASLRGWKLQPAMRGDQPIEVTAILGFGIDTNDRF*
Ga0058891_156869613300004104Forest SoilVLEAGPAGMTAEVIAALHSWKFQPAMRGNQPVAVTAILGFGISTDDRF*
Ga0062386_10011818033300004152Bog Forest SoilMTGQVLSALRSWKFQPAMKGDQPVEVTAILGFGIDTNDRY*
Ga0062595_10049624713300004479SoilPGPANMTAKILSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF*
Ga0066690_1038021213300005177SoilPAQMTAKVVAALRNWKFQPATRNNQPLEVTAIIGFGIDTSDRF*
Ga0070709_1036987613300005434Corn, Switchgrass And Miscanthus RhizosphereTGKIVAALRGWKFQPAMRGNEPVEVTAILGFNIDTNDRF*
Ga0070709_1170813323300005434Corn, Switchgrass And Miscanthus RhizospherePGPAEVTAKVITALRSWKLQPVMRNNQPIQVDAILGFGIDTNDRF*
Ga0070713_10095929713300005436Corn, Switchgrass And Miscanthus RhizosphereGNLHVLEAGPATMTAKVVAALHSWKFQPAMKNNQPVEVNAILGFGINTNDRF*
Ga0070707_10227365413300005468Corn, Switchgrass And Miscanthus RhizosphereTDTTTKVLASLPNWKFSPALRGDQPVEVTVYLGFNIDTKDRF*
Ga0070733_1022379513300005541Surface SoilVRVLEAGPASMTAKIVAALRNWKFQPAMRGDQPVEVTAILGFGIDTNDRF*
Ga0070732_1019347613300005542Surface SoilNVRVLEAGPADMTAKVVAALNNWKFQPALRGDQPVEVTAILGFGINTNDRF*
Ga0070732_1082489513300005542Surface SoilLEAGPAGMTAKVVAALRSWKFQPAMRNNQPLEVTAILGFGIDTNDRF*
Ga0066695_1037509823300005553SoilKVLASLPNWKFSPALRGDQPVEVTVYLGFNIDTKDRF*
Ga0068854_10214559223300005578Corn RhizosphereLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF*
Ga0070761_1026014813300005591SoilEMTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF*
Ga0070762_1008021013300005602SoilTGSAEMTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF*
Ga0070764_1005096523300005712SoilTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF*
Ga0075289_101420213300005888Rice Paddy SoilGPASMTAKVLAALRSWKFQPAMRNDQPVDVTAILGFGVNTDDRF*
Ga0080026_1001503923300005952Permafrost SoilAGNLKNVRVLEPGPADVTAKIVAALRAWKFQPAMRGNEAVEVTAILGFNIDTNDRF*
Ga0075026_10098051723300006057WatershedsAVMTAKILADLRSWKFQPAMRSNQPVEVTAILGFGVDTNDRF*
Ga0075017_10078234413300006059WatershedsAKIIAALRGWKLQPAMRGDQPIEVTAILGFGIDTNDRF*
Ga0075030_10095704323300006162WatershedsAKVVAALNNWKFQPALRGDQPVEVTAILGFGINTNDRF*
Ga0075030_10141021513300006162WatershedsLEAGPAGMTAKVVAALRSWKFQPAMRNNQPVEVTAILGFGIDTNDRF*
Ga0070716_10085799513300006173Corn, Switchgrass And Miscanthus RhizosphereSALQSWKFQPAMRNDQPVGVTAILGFGVNTDDRF*
Ga0075014_10011535813300006174WatershedsGMTAKVVAALRSWKFQPAMRNNQPVEVTAILGFGIDTNDRF*
Ga0070765_10216808913300006176SoilTSKVLSALRSWKFQPALRGNQPVEVTAILGFVIDTNDRF*
Ga0099830_1083098023300009088Vadose Zone SoilAALSKWKFRPALRGNQPVEVNAFLGFNIDTNDRF*
Ga0116132_121141713300009646PeatlandADMTAKVMLALRGWKFQPAMRGDQPVEVTAILGFGIDTNDRN*
Ga0116223_1051133523300009839Peatlands SoilVVALRSWKFQPALRGGQPVEVSAILGFGINTDDRF*
Ga0134062_1023716333300010337Grasslands SoilEPGPANMTAKVLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF*
Ga0074045_1064781323300010341Bog Forest SoilIAKVLAALGGWKFRPALRGGQPVEVTAILGFNIDTNDRY*
Ga0126370_1061220223300010358Tropical Forest SoilVLEAGPATMTAKVVAALNSWKFQPALRGDQPVEVTAILGFGVDTNDRF*
Ga0126370_1082191813300010358Tropical Forest SoilLTAKVLAALRTWKFQPAMRNNQPVEVTAILGFGIDTSDRF*
Ga0134125_1172855813300010371Terrestrial SoilSGPAAMTAKVLSALRSWKFQPAMRNDQPVDVTAILGFGVNTDDRF*
Ga0136449_10046346333300010379Peatlands SoilGPADMTAKVMTALRSWKFQPAMRGTQPVEVTAILGFGIDTNDRF*
Ga0136449_10308728313300010379Peatlands SoilLAALRAWKFQPALRGSQPVDVIAILGFNIDTNDRF*
Ga0126383_1006486553300010398Tropical Forest SoilVLEPGPATMTAKVVAALRSWKFQPAMRNSQPVEVTAILGFGIDTNDRF*
Ga0134122_1031107633300010400Terrestrial SoilEPADAGMTSKVLAALPRWKFQPAMRDGKAVEVNAILGFNIDTNDRF*
Ga0105246_1132558323300011119Miscanthus RhizosphereVIAALPHWKFKPAMRVNQPVEVTAILGFNIDTNDRY*
Ga0137407_1152804823300012930Vadose Zone SoilGMTAKILAAVRGWKFQPAMRGNQPVEVTAILGFGISTDDRF*
Ga0157375_1020605613300013308Miscanthus RhizosphereVMMAKVIAALPHWKFKPAMRVNQPVEVTAILGFNIDTNDRN*
Ga0157376_1193676623300014969Miscanthus RhizosphereMTAKVLAALNGRKFRAALRGDQPVEVTAILGFGIDTNDRF*
Ga0137418_1047924923300015241Vadose Zone SoilMMAKVMAALPHWKFKPATRGAQPVEVTAILGFNVDTSDRY*
Ga0132258_1083708213300015371Arabidopsis RhizosphereAQMTAKVLAALRTWKFQPAMRNNRPVEVTAILGFGIDTNDHF*
Ga0182036_1163634213300016270SoilLEPASATVTAKIVAALRAWKFQPAMKNNQPVEVTAILGFGIDTNDRF
Ga0182037_1043474523300016404SoilKVLDPGPAAMTAKVLAALSSWKFQPAMRGTQSVELTAILGFGIDTNDRF
Ga0187818_1009125213300017823Freshwater SedimentIRNVRVLEAGPAGMTAKVPSDLRSWKFQPAMRNNQPVEVTAILGFGINTDDRF
Ga0187817_1080566223300017955Freshwater SedimentAKIVAALRSWKFQPAMRGNQPVEVTAILGFGIDTNDRF
Ga0187817_1107528313300017955Freshwater SedimentAEMTAKILAALRTWKFQPAMRGNQPVEVTAILGFGVDTNDRF
Ga0187778_1100159913300017961Tropical PeatlandAKVLAALHSWKFQPALRGDQPVEVTAILGFNIDTNDRF
Ga0187783_1009944033300017970Tropical PeatlandGPATMTAKIRSALRAWKFQPAMRNGQPVEVNAILGFNITTDDVTNGSNLR
Ga0187781_1003068643300017972Tropical PeatlandLTNLRVLEAGPPGMTAKLLASLRTWKFEPAMRNKQPVEVTAILGFGIDTNDRF
Ga0187823_1022892423300017993Freshwater SedimentRNVRVLEAGPAGMTAKVLAALRGWKFQPAMRGNQPVEVTAILGFGIDTNDRF
Ga0187804_1000676813300018006Freshwater SedimentAMNSKVLAALSSWKFRPAFHGDQPVEVTAILGFDIDTR
Ga0187810_1018903523300018012Freshwater SedimentGPADMTARVQTALHGWKFRPALRGDQPVEVTAILGFNIDTNDRF
Ga0187784_1089098413300018062Tropical PeatlandKVLAALRTWKFQPALRGSEPVEVTAILGFNIDTNDRF
Ga0187772_1015312423300018085Tropical PeatlandRVLEPGPADMTAKILAALRAWKFRPALREDQPIEVTAIIGFNIDTNDRF
Ga0187772_1055356913300018085Tropical PeatlandRAKILSALQSWKFQPAVRGNEPVEVDAILGFGVDTR
Ga0187771_1128588013300018088Tropical PeatlandMTAKVLAALRAWKFRPALRSDQPIEVTAILGFNIDTNDRF
Ga0066662_1001707973300018468Grasslands SoilVLEPGPANMTAKVLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF
Ga0182025_111161723300019786PermafrostPGPAEMTAKIVAALRSWKFQPAMRGNQPVAVTAILGFGIDTNDRF
Ga0215015_1025874613300021046SoilVMAALESWKFRPATRGGQPVEVNALLGFGIDTNDRN
Ga0210405_1083381823300021171SoilLSALRIWKFEPAMRGNQPVEVTAILGFGVDTNDRF
Ga0210383_1055190433300021407SoilLPALRSWKFEPALRGTQPVDVTAILGFGIDTNDRF
Ga0210409_1059895913300021559SoilTSGNLKNLRVLEAGPAGMTARILPALRAWKLEPAMRGGQPVEVTAILGFGINTDDRF
Ga0213851_143858913300021860WatershedsKNPRVLDPDPPQMTARVLAALRSWKFQPATRNNQPLEVTAIIGFGIDTSDHF
Ga0208850_106815023300025457Arctic Peat SoilDMTAKVLAALRSWKFQPAMRGTQPVEVTAILGFGIDTNDRF
Ga0207679_1092294723300025945Corn RhizosphereANMTAKILSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF
Ga0207703_1045255433300026035Switchgrass RhizosphereQVLEPADAGMTSKVLAALPRWKFQPAMRDGKAVEVNAILGFNIDTNDRF
Ga0209055_109584323300026309SoilVVAALRNWKFQPATRNNQPLEVTAIIGFGIDTSDRF
Ga0209474_1030277433300026550SoilAKVLSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF
Ga0207776_102203623300027035Tropical Forest SoilNMTAKVLAALRGWKFQPALRGDQPVEVTAIIGFGIDTNDRF
Ga0209448_1016157513300027783Bog Forest SoilDMTAKVLIALRAWKFQPAILGNDPVEVTAILGFGVDTNDRF
Ga0209039_1041302823300027825Bog Forest SoilLAALRSWKFQPAKRGDQPVEVTAILGFGIDTNDRF
Ga0209580_1029684723300027842Surface SoilIIAALRSWKFQPATRNNQPVEVTAILGFGIDTNDRF
Ga0209580_1045309023300027842Surface SoilEAGPATMTAKVLAALPSWKFQPAMRGNQPVEVTAILGFGIDTNDRF
Ga0209580_1059702623300027842Surface SoilRVLEAGPAGMTAKVVAALRSWKFQPAMRNNQPLEVTAILGFGIDTNDRF
Ga0209167_1005390823300027867Surface SoilNVRVLEAGPASMTAKIVAALRNWKFQPAMRGDQPVEVTAILGFGIDTNDRF
Ga0209167_1057447013300027867Surface SoilGSATMTAKVLAALRTWKFQPAMRNNQPVEVTAILGFGIDTSDRF
Ga0209579_1007207033300027869Surface SoilKGIRVLEAGPADMTAKVLAALRSWKFQPAMRDNQPVEVTAILGFGINTNDRF
Ga0209275_1007246113300027884SoilSAEMTAKLVAALRTWKFQPAMRGDQPVEVTAILGFNIDTNDRF
Ga0209698_1050357613300027911WatershedsDMTAKVLTALRSWKFQPAMRGSEPVAVTAILGFGIDTNDRF
Ga0209698_1097769613300027911WatershedsLEPGPPDMTAKVLSAMLSWKFQPALRGDHPVEVTAILGFGIDTNDRF
Ga0307504_1013236813300028792SoilPAVMTSKVLAALSKWKFRPALRGNQPVEVNAFLGFNIDTNDRF
Ga0302227_1008126013300028795PalsaLEAGPATMTAKVLAALRNWKFQPALRGDQPVEVTAILGFGIDTNDRF
Ga0222749_1000908973300029636SoilESSGSEMTSKVMAALPGWKFRPAMRGDQPVEVNAILGFGIDTNDRF
Ga0311347_1072470013300029923FenAAETTSKILAALPNWKFRPAFRGNEPVEVTAILGFGIDTR
Ga0311338_1059439833300030007PalsaMTAKILVALRSWKFQPAMRGAQPVQVTAILGFGIDTNDRF
Ga0302176_1009456933300030057PalsaLKNVRVLEAGPATMTAKVLAALRNWKFQPALRGDQPVEVTAILGFGIDTNDRF
Ga0311357_1184182523300030524PalsaAGMTAKVVASLRTWKFEPATRNKQPVEVTAILGFGIDTNDRF
Ga0170834_10641103633300031057Forest SoilKNIRVREPGPAGMTSKILAALRSWKFQPAMRGDQPVEITAILGFGIDTNDRF
Ga0170824_12078414523300031231Forest SoilAGMTAKVLAALHSWKFQPAMRGDQPVPVTAILGFGIDTNDRF
Ga0302307_1042621423300031233PalsaLKNVRVLEAGPAGMTAKVVASLRTWKFEPATRNKQPVEVTAILGFGIDTNDRF
Ga0170820_1316633813300031446Forest SoilLKGIRVLEAGPADMTAKVLAALGSWKFQPAMRANQPVEVTAILGFGINTNDRF
Ga0170819_1763221323300031469Forest SoilPAGMTAKILAALPSWKFQPAMRGDQPVEITAILGFGIDTNDRF
Ga0265314_1061217423300031711RhizosphereVLAALRSWKFQPAMRGDQPVEVTAILGFGIDTNDRF
Ga0307474_1011589923300031718Hardwood Forest SoilAEMTSKILSALRSWKFQPALRGNQPVEVTAILGFGIDTNDRF
Ga0307475_1086755413300031754Hardwood Forest SoilGMTAKVLAALRSWKFQPAMRGTQPVEVTAILGFGIDTNDRF
Ga0306926_1077194323300031954SoilQMTAKVLAALHTWKFQPAMRNNQPVEVTAILGFGIDTNDRF
Ga0308176_1177452533300031996SoilGNVRVLEPGPANMTAKILSALRSWKFQPAMRNDQPVGVTAILGFGVNTDDRF
Ga0306924_1053928213300032076SoilMTAKVLAALSSWKFQPAMRGTQSVELTAILGFGIDTNDRF
Ga0307470_1016704713300032174Hardwood Forest SoilVRVREPGPAGMTAKILAALRSWKFQPAMRGDQPVEITAILGFGIDTNDRF
Ga0307471_10200493023300032180Hardwood Forest SoilMTSKVLAALRNWKFQPATRNNQPLEVTAIFGFGIDTSDHF
Ga0335085_1036769923300032770SoilGPAEMTAKVIAALRSWKFQPATRGNQPVEVTAILGFGIDTNDRF
Ga0335079_1006919543300032783SoilLEAGPADMTAKVVAALRSWKFQPAMRGDQPVEVSAILGFGIDTNDRF
Ga0335078_1013769033300032805SoilVHVLEGPNDATARVVAALRSWKFQPALRGEQPVEVTAILGFAIDTNDRF
Ga0335080_1034309813300032828SoilGPATMTAKVIAALRTWKFQPAMRNSQPVEVTAILGFGIDTNDRF
Ga0335080_1076717913300032828SoilMTAKILAALPTWKFQPAMRNNQPVEVTAILGFSINTDDRF
Ga0335070_1036927113300032829SoilLDASGNFRNLHVLEGPAEVTPRVAAALRAWKFQPAMRGDKPVEVTAILGFGIDTNDRF
Ga0335081_1092143613300032892SoilAMTAKVMAALKNWKFQPALRSGQPVEVTAILGFGINTDDRL
Ga0335083_1010261223300032954SoilLEAGSATMTAKVLAALRTWKFQPAMRNNQPVEVTAILGFGIDTSDRF
Ga0335084_1157043923300033004SoilTAKVVAALRSWKFQPAMKNNQPVEVTAILGFGIDTNDRFWV
Ga0335077_1146815013300033158SoilATTAKILAALPTWKFQPAMRNNQPVEVTAILGFGINTDDRF
Ga0370484_0072275_745_8673300034125Untreated Peat SoilMTAKVLAALRSWKFQPAMRGDQPVEVTAILGFGIDTNDRF
Ga0370515_0235734_664_7773300034163Untreated Peat SoilKVLAALRNWKFQPALRGDQPVEVTAILGFGIDTNDRF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.