NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072667

Metagenome / Metatranscriptome Family F072667

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072667
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 43 residues
Representative Sequence MRLLRRLLGRRRPMPRPADPERLQRIYRETHRHVEELRRAA
Number of Associated Samples 101
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.33 %
% of genes near scaffold ends (potentially truncated) 23.14 %
% of genes from short scaffolds (< 2000 bps) 76.86 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.165 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.091 % of family members)
Environment Ontology (ENVO) Unclassified
(20.661 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.893 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF12697Abhydrolase_6 24.79
PF00271Helicase_C 24.79
PF03602Cons_hypoth95 23.97
PF01467CTP_transf_like 5.79
PF02645DegV 1.65
PF00550PP-binding 0.83
PF00248Aldo_ket_red 0.83
PF01336tRNA_anti-codon 0.83
PF00885DMRL_synthase 0.83
PF17191RecG_wedge 0.83
PF00496SBP_bac_5 0.83
PF02887PK_C 0.83
PF03780Asp23 0.83
PF03466LysR_substrate 0.83
PF01799Fer2_2 0.83
PF00892EamA 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 23.97
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 23.97
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 23.97
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 23.97
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 23.97
COG00546,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)Coenzyme transport and metabolism [H] 0.83
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.83
COG1302Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) familyFunction unknown [S] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.17 %
UnclassifiedrootN/A19.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig113392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300004114|Ga0062593_101591371Not Available709Open in IMG/M
3300004633|Ga0066395_10800711Not Available565Open in IMG/M
3300005093|Ga0062594_100591233All Organisms → cellular organisms → Bacteria → Terrabacteria group970Open in IMG/M
3300005093|Ga0062594_101275892All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300005171|Ga0066677_10445127All Organisms → cellular organisms → Bacteria → Terrabacteria group741Open in IMG/M
3300005175|Ga0066673_10049048All Organisms → cellular organisms → Bacteria2121Open in IMG/M
3300005178|Ga0066688_10084805All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300005179|Ga0066684_10037093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2708Open in IMG/M
3300005329|Ga0070683_100132107All Organisms → cellular organisms → Bacteria2363Open in IMG/M
3300005332|Ga0066388_100227627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2496Open in IMG/M
3300005332|Ga0066388_103806975Not Available770Open in IMG/M
3300005336|Ga0070680_101047985All Organisms → cellular organisms → Bacteria → Terrabacteria group705Open in IMG/M
3300005337|Ga0070682_101143482Not Available654Open in IMG/M
3300005434|Ga0070709_11016940All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005435|Ga0070714_100002733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13002Open in IMG/M
3300005439|Ga0070711_100152748All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300005440|Ga0070705_100052818Not Available2376Open in IMG/M
3300005450|Ga0066682_10200738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300005468|Ga0070707_100006214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11123Open in IMG/M
3300005524|Ga0070737_10014808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5842Open in IMG/M
3300005526|Ga0073909_10003652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4537Open in IMG/M
3300005548|Ga0070665_102188208All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300005575|Ga0066702_10979917All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005577|Ga0068857_101672444All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005587|Ga0066654_10216890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300005614|Ga0068856_100400995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1391Open in IMG/M
3300005764|Ga0066903_100146883All Organisms → cellular organisms → Bacteria3373Open in IMG/M
3300005764|Ga0066903_100148303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3361Open in IMG/M
3300005764|Ga0066903_100154252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3309Open in IMG/M
3300005764|Ga0066903_100931087All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300005764|Ga0066903_104440400All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005764|Ga0066903_105882723All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005841|Ga0068863_100372249All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300005842|Ga0068858_100535538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1133Open in IMG/M
3300005891|Ga0075283_1120356Not Available503Open in IMG/M
3300005897|Ga0075281_1012880All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300006028|Ga0070717_10031334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli4277Open in IMG/M
3300006028|Ga0070717_10118155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2269Open in IMG/M
3300006046|Ga0066652_100656647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300006173|Ga0070716_100818155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300006804|Ga0079221_10991424All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300006806|Ga0079220_12087974Not Available507Open in IMG/M
3300006852|Ga0075433_10544803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1020Open in IMG/M
3300006854|Ga0075425_102235187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300009012|Ga0066710_100391528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2069Open in IMG/M
3300009101|Ga0105247_10983859All Organisms → cellular organisms → Bacteria → Terrabacteria group658Open in IMG/M
3300009177|Ga0105248_10550940All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300010048|Ga0126373_12666517Not Available557Open in IMG/M
3300010154|Ga0127503_10280750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium837Open in IMG/M
3300010301|Ga0134070_10289121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300010335|Ga0134063_10389557All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300010359|Ga0126376_11583821All Organisms → cellular organisms → Bacteria → Terrabacteria group687Open in IMG/M
3300010361|Ga0126378_13078119Not Available531Open in IMG/M
3300010362|Ga0126377_11154675Not Available844Open in IMG/M
3300010362|Ga0126377_12318999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300010362|Ga0126377_12734556All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300010366|Ga0126379_13021584All Organisms → cellular organisms → Bacteria → Terrabacteria group563Open in IMG/M
3300010373|Ga0134128_10301080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1796Open in IMG/M
3300010396|Ga0134126_10955708Not Available961Open in IMG/M
3300012206|Ga0137380_10260996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1559Open in IMG/M
3300012207|Ga0137381_11708245Not Available520Open in IMG/M
3300012207|Ga0137381_11730647Not Available515Open in IMG/M
3300012210|Ga0137378_11828860All Organisms → cellular organisms → Bacteria → Terrabacteria group511Open in IMG/M
3300012285|Ga0137370_10295010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300012356|Ga0137371_10193054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1595Open in IMG/M
3300012955|Ga0164298_10354237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300012957|Ga0164303_10150964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300012960|Ga0164301_10152362All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300012960|Ga0164301_10572007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium829Open in IMG/M
3300012961|Ga0164302_10281453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1075Open in IMG/M
3300012971|Ga0126369_11150214Not Available865Open in IMG/M
3300012971|Ga0126369_11320457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300012971|Ga0126369_13319624All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012984|Ga0164309_10282755All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300012988|Ga0164306_10338333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1111Open in IMG/M
3300013296|Ga0157374_12546188All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300013307|Ga0157372_13137267All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300013772|Ga0120158_10199770Not Available1046Open in IMG/M
3300014326|Ga0157380_12138706All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300014497|Ga0182008_10419660All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300014969|Ga0157376_10328527All Organisms → cellular organisms → Bacteria → Terrabacteria group1456Open in IMG/M
3300014969|Ga0157376_12859263Not Available522Open in IMG/M
3300015261|Ga0182006_1331973All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300015262|Ga0182007_10255092All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300015357|Ga0134072_10445359Not Available521Open in IMG/M
3300016422|Ga0182039_10804554All Organisms → cellular organisms → Bacteria → Terrabacteria group834Open in IMG/M
3300017966|Ga0187776_10000307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria23880Open in IMG/M
3300018431|Ga0066655_10441966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300018482|Ga0066669_10831299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300020070|Ga0206356_10671740All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300021560|Ga0126371_13225646All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300024055|Ga0247794_10261615All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300025912|Ga0207707_10027158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5005Open in IMG/M
3300025921|Ga0207652_10206122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1770Open in IMG/M
3300025922|Ga0207646_10000268All Organisms → cellular organisms → Bacteria71093Open in IMG/M
3300025927|Ga0207687_10206251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1539Open in IMG/M
3300025928|Ga0207700_10007827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6569Open in IMG/M
3300025928|Ga0207700_10073111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2646Open in IMG/M
3300025929|Ga0207664_10153497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1958Open in IMG/M
3300025929|Ga0207664_10282294All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300025990|Ga0208527_1023248Not Available745Open in IMG/M
3300026088|Ga0207641_11818147All Organisms → cellular organisms → Bacteria → Terrabacteria group611Open in IMG/M
3300026116|Ga0207674_11844762All Organisms → cellular organisms → Bacteria → Terrabacteria group571Open in IMG/M
3300026300|Ga0209027_1025485Not Available2240Open in IMG/M
3300026310|Ga0209239_1031515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2517Open in IMG/M
3300026326|Ga0209801_1079177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1443Open in IMG/M
3300026330|Ga0209473_1176422All Organisms → cellular organisms → Bacteria → Terrabacteria group836Open in IMG/M
3300026547|Ga0209156_10353803Not Available633Open in IMG/M
3300027773|Ga0209810_1009704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7479Open in IMG/M
3300027821|Ga0209811_10009364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Thermincola → Thermincola potens3141Open in IMG/M
3300027874|Ga0209465_10178834All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300031226|Ga0307497_10413501Not Available647Open in IMG/M
3300031753|Ga0307477_10123021All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300031938|Ga0308175_100000015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria160565Open in IMG/M
3300031938|Ga0308175_101066639Not Available895Open in IMG/M
3300031938|Ga0308175_103161791Not Available511Open in IMG/M
3300031939|Ga0308174_10001912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10008Open in IMG/M
3300031939|Ga0308174_10766138All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300032770|Ga0335085_10048699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5748Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.13%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.13%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.48%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.48%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.65%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300005897Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025990Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0379.000063902166559005SimulatedMRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVE
Ga0062593_10159137123300004114SoilMKLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA*
Ga0066395_1080071113300004633Tropical Forest SoilMKLIRRLLGRRKSAPRLLMLQADSERLQQIYRETHRQVEELRRAA*
Ga0062594_10059123313300005093SoilMRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA*
Ga0062594_10127589223300005093SoilMRLIRRLLGRQRPMLRAADPERLQRIYRETHRHVEELRRAA*
Ga0066677_1044512723300005171SoilMRLVALLLGRRRPAPRPTPPADPERLQRIYRETQRHVENLRRAA*
Ga0066673_1004904833300005175SoilMRVLRRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA*
Ga0066688_1008480523300005178SoilMRLLTRLVRRLLGRGRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA*
Ga0066684_1003709323300005179SoilMRVLRRLLHRRRPTPRPADPERLQRIYRETHRHVEELRRAA*
Ga0070683_10013210723300005329Corn RhizosphereMRLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA*
Ga0066388_10022762753300005332Tropical Forest SoilMRLLVLLVDRLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA*
Ga0066388_10380697523300005332Tropical Forest SoilMKLVRRLFRRRRPMPRLADPERLQRIYRETHRHVEELRRA
Ga0070680_10104798523300005336Corn RhizosphereMKLIRRLLGRRGSGPRPADPERLQRIYRETHRHVEELRRAA*
Ga0070682_10114348223300005337Corn RhizosphereRMKLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA*
Ga0070709_1101694023300005434Corn, Switchgrass And Miscanthus RhizosphereMKLLRRLLGRRPPAPRPADPERLQRIYRETHRQVEDLRRAA*
Ga0070714_10000273333300005435Agricultural SoilMKLLVRLFRRRAAPLPVPPAEQERLQRIYRETHRHVADLRRTA*
Ga0070711_10015274813300005439Corn, Switchgrass And Miscanthus RhizosphereMKLIRRLLGRRRPMLRAADPERLQRIYRKTHRHVEELRRAA*
Ga0070705_10005281833300005440Corn, Switchgrass And Miscanthus RhizosphereMKLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRA
Ga0066682_1020073823300005450SoilMRLLRRLLRRRRPTARPADPERLQRIYRETHLHVEELRRAA*
Ga0070707_10000621443300005468Corn, Switchgrass And Miscanthus RhizosphereMMVLRRLFGRRRPMPRPADPERLQRIYRETHRHVEELRRAA*
Ga0070737_1001480843300005524Surface SoilVRGSLLLLRLVRRLAGRRPPPASTPAADPERLQRVYRETRRRVERLRRAA*
Ga0073909_1000365263300005526Surface SoilMKLIRRLLGRPRPMLHPADPERLQRIYRETHRHVEELRRAA*
Ga0070665_10218820823300005548Switchgrass RhizosphereMRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRH
Ga0066692_1032561833300005555SoilRMMRLLALLRRGRSRPAPRPLDPERLQRIYRETHRQVEELRRAA*
Ga0066702_1097991723300005575SoilMRLLTRLVRRLLGRRRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA*
Ga0068857_10167244423300005577Corn RhizosphereMRLIRRLLGRRRPMLRAAVPERRQRIYRETHRHVEELRRAA*
Ga0066654_1021689013300005587SoilMRVLRRLLRRRLPSPRPADPERLQRIYRETHRHVEELRRAA*
Ga0068856_10040099533300005614Corn RhizosphereFGPRRPMLRPADPARLQHIYRETHRHVEDLRRAA*
Ga0066903_10014688343300005764Tropical Forest SoilMRILLAVIRRLFGGTRPRQRPTPPPDSDRFDRIYRETHRDVEDLRRAA*
Ga0066903_10014830323300005764Tropical Forest SoilMRLFRRLLGRRRPVPRPADPERLQRIYRETHRRVEELRRAA*
Ga0066903_10015425243300005764Tropical Forest SoilMRLVRRLLGRRRPLPRPTDPERLQRIYRETHRRVEELRRAA*
Ga0066903_10093108723300005764Tropical Forest SoilMKLLRRLLGRRPPAPRPTDPERLQRVYRETHRQVEELRRAA*
Ga0066903_10444040023300005764Tropical Forest SoilVFLGLRRKRRVVVPADPERLQQIYRETHRHVEDLRRAA*
Ga0066903_10588272323300005764Tropical Forest SoilMTLIRRLLSRRRPASRLLLLQADSERLQQIYRETHRQVEELRRAA*
Ga0068863_10037224933300005841Switchgrass RhizosphereMRLIRRLLSRRRPMLRAADPERLQRIYRETHRHVEELRRAA*
Ga0068858_10053553833300005842Switchgrass RhizosphereVRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYREAQRHVEELRRAA*
Ga0075283_112035623300005891Rice Paddy SoilMRLLVLLVRRLLGRRQPTPRPRPPADPERLQRIYRDTQRQVEELRRAA*
Ga0075281_101288023300005897Rice Paddy SoilMRLLVLLVRRLLGRGQPTPRPRPPADPERLQRIYRDTQRQVEELRRAA*
Ga0070717_1003133433300006028Corn, Switchgrass And Miscanthus RhizosphereMKLLRRLLGRRPPPPRPADPERLQRIYRETHRHVEDLRRAA*
Ga0070717_1011815523300006028Corn, Switchgrass And Miscanthus RhizosphereMRRLFALLLGRPRRTAPPIDSERLLQIYRETHEHVEELRRAA*
Ga0066652_10065664723300006046SoilMRLLRRLLRRRRPMARPADPERLQRIYRETHRHVEELRRAA*
Ga0070716_10081815523300006173Corn, Switchgrass And Miscanthus RhizosphereMKLFRRLFARRRPAPRLADPERLHRIYRETHRQVEGLRRAA*
Ga0079221_1099142423300006804Agricultural SoilMKLIHRLLGRRKPAPRPVDSERLHRIYRETHRQVEELRRAA*
Ga0079220_1208797423300006806Agricultural SoilMRLIRRLLARRRTVPRLADPERLQQIYRETHRRVEELRRAA*
Ga0075433_1054480313300006852Populus RhizosphereIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA*
Ga0075425_10223518723300006854Populus RhizosphereMRTLLLLIDHLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA*
Ga0066710_10039152853300009012Grasslands SoilMRVLRRLLHRRRPMPRPADPGRLQRIYRETHRHVEELRRAA
Ga0105247_1098385913300009101Switchgrass RhizosphereMRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYREAQRHVEELRRAA*
Ga0105248_1055094013300009177Switchgrass RhizosphereMRLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELR
Ga0126373_1266651723300010048Tropical Forest SoilMKLLRRLRRRRSPALRLADPDDLQRIYRETHRQVEELRRAA*
Ga0127503_1028075023300010154SoilMRLLRRLLSRRRSKPRPADPERLLRIYRETHRHVEELRRAA*
Ga0134070_1028912123300010301Grasslands SoilMRLLRRLLRRRRPIARPADPERLQRIYRETHRHVEELRRAA*
Ga0134063_1038955723300010335Grasslands SoilMRLLTRLVRRLLGRGRPPSRPTPPADPERLQRIYRETHRHVEDLR
Ga0126376_1158382123300010359Tropical Forest SoilMRLLVLLVDRLLGRRRRPAPRPRPPHDPECLQRVYRETQR
Ga0126378_1307811913300010361Tropical Forest SoilAGVRLVRRLLGRRRPLPRPTDPERLQRIYRETHRRVEELRRAA*
Ga0126377_1115467523300010362Tropical Forest SoilRLLVLLVDRLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA*
Ga0126377_1231899923300010362Tropical Forest SoilMKLIRRLLGRRRPASRLLLLQADSERLQQIYRETHRQVEELRRAA*
Ga0126377_1273455613300010362Tropical Forest SoilMTLLRRLFGRRRPTPRAADPERLQRIYRETHRQVE
Ga0126379_1302158423300010366Tropical Forest SoilVRLLRRLLGHRRPALRPADPEHLQRIYRETHRHIEELRRAA*
Ga0134128_1030108023300010373Terrestrial SoilMRLLARLIRRLLGRRRPAPRPVPPTDPERLQRIYRETHRQVEDLRRAA*
Ga0134126_1095570823300010396Terrestrial SoilMRLLLLRLLRRRRPVPRPADSERLQRIYRETHRHVEKL
Ga0137380_1026099623300012206Vadose Zone SoilMRLLAQLVRRLLGRRRPAPRFVPPTDPERLHRIYCDTHREVEDLRRAA*
Ga0137381_1170824513300012207Vadose Zone SoilMRLLSQLVRRLLGRRRPAPRPVPSTDPERLHRIYCDTHREVEDLRRAA*
Ga0137381_1173064723300012207Vadose Zone SoilMRLLVPINRRLRGRSRPAPGPLDPERLQRIYRETHRQVEELRRAA*
Ga0137378_1182886023300012210Vadose Zone SoilMRLLTRLVRRLLRRGRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA*
Ga0137370_1029501013300012285Vadose Zone SoilLRRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA*
Ga0137371_1019305423300012356Vadose Zone SoilMRLLSQLVRRLLDRRRPGPRPVPPTDPERLHRIYCDTHREVEDLRRAA*
Ga0164298_1035423723300012955SoilMKLIRRLLGRRRPVLRPADPERLQLIYRETHRHVEELRRAA*
Ga0164303_1015096423300012957SoilMKLIRRLLGRPRPILHPADPERLQRIYRETHRHVEELRRAA*
Ga0164301_1015236223300012960SoilMKLIRRLVSRRGPGPRPADPERLQRIYRETQRQVEELRRAA*
Ga0164301_1057200713300012960SoilMQLIRRLLGRPRPILHPADPERLQRIYRETHRHVEELRRAA*
Ga0164302_1028145313300012961SoilRMKLIRRLLGRPRPMLHPADPERLQRIYRETHRHVEELRRAA*
Ga0126369_1115021423300012971Tropical Forest SoilMRLILRLLGRRRPMPRPADPERLQRIYRDTHRHVEELRRAA*
Ga0126369_1132045713300012971Tropical Forest SoilMRLILRLLGRRRPVPRPADPERLQQIYRETHRTVEELRRAA*
Ga0126369_1331962423300012971Tropical Forest SoilVKLIHRLFRRRRPEPRPVDSEVLHRIYRETHRQVEELRRAA*
Ga0164309_1028275533300012984SoilMKLIRRLLGRPRPMLHPADPERLQRIYRETHRRVEELRRAA*
Ga0164306_1033833333300012988SoilRMKLIRRLLGRRRPMLRATDAERLQRIYRETHRHVEELRRAA*
Ga0157374_1254618823300013296Miscanthus RhizosphereVRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA*
Ga0157372_1313726723300013307Corn RhizosphereMKLIRRLLGRRGSGPRPADPERLQRIYRVTHRHVEELRRAA*
Ga0120158_1019977023300013772PermafrostMRLVVRVSRLLSRRQPTPRPGPPADPERLQRIYRETQRHLEDLRRVA*
Ga0157380_1213870623300014326Switchgrass RhizosphereMRLIRRLLGRRRPTLRAADPERLQRIYRETHRHVEELRRAA
Ga0182008_1041966023300014497RhizosphereVRLLAQLIRRLLGGGRPAPRPVPPTDPERLQRIYRETHRQVEDLRRAA*
Ga0157376_1032852733300014969Miscanthus RhizosphereMRLIRRLLGRRRPMLRAADTERLQRIYRETHRHVEELRRAA*
Ga0157376_1285926323300014969Miscanthus RhizosphereMKLVRRLLGRRRPMPRPADAERLQQIYRETHRQVEELRRAA*
Ga0182006_133197323300015261RhizosphereVRLLAELLRRLLGRRRSAPRPVPPTDPERLQRIYRETHRQVEDL
Ga0182007_1025509223300015262RhizosphereVRLLAELLRRLLGRRRSAPRPVPPTDPERLQRIYRETHRQVEDLRRAA*
Ga0134072_1044535913300015357Grasslands SoilRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA*
Ga0182039_1080455423300016422SoilMRLLRRLLGRRRPMPRPADPERLQRIYRETHRHVEELRRAA
Ga0187776_10000307223300017966Tropical PeatlandMRLLVLLIDRLLGRRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA
Ga0066655_1044196623300018431Grasslands SoilMRLLRRLLRRRRPMARPADPERLQRIYRETHRHVEELRRAA
Ga0066669_1083129923300018482Grasslands SoilMSVLRRLLHRRRPMPRPADPERLQRIYRETHRHVEELRRAA
Ga0206356_1067174013300020070Corn, Switchgrass And Miscanthus RhizosphereMRLIRRLLGRRRPMLRAADPEHLQRIYRETHRHVEELRRAA
Ga0126371_1322564623300021560Tropical Forest SoilMKLLRRLLGRRRPAPRPADPERLQRIYRETHRQVEELRRAA
Ga0247794_1026161523300024055SoilMRLIRRLLGRRRPMLRAADPERLQRIYRETHRHVEELRRAA
Ga0207707_1002715853300025912Corn RhizosphereMKLIRRLLGRRGSGPRPADPERLQRIYRETHRHVEELRRAA
Ga0207652_1020612243300025921Corn RhizosphereMKLIRRLLGRPGSGPRPADPERLQRIYRETHRHVEELRRAA
Ga0207646_10000268633300025922Corn, Switchgrass And Miscanthus RhizosphereMMVLRRLFGRRRPMPRPADPERLQRIYRETHRHVEELRRAA
Ga0207687_1020625143300025927Miscanthus RhizosphereLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA
Ga0207700_1000782713300025928Corn, Switchgrass And Miscanthus RhizosphereMRLLVLFIHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHV
Ga0207700_1007311113300025928Corn, Switchgrass And Miscanthus RhizosphereHRLLGRRRPAPRPRPPHDPERLQRVYRETQRHVEELRRAA
Ga0207664_1015349733300025929Agricultural SoilMKLLRRLLGRRPPPPRPADPERLQRIYRETHRHVEDLRRAA
Ga0207664_1028229423300025929Agricultural SoilMKLLVRLFRRRAAPLPVPPAEQERLQRIYRETHRHVADLRRTA
Ga0208527_102324813300025990Rice Paddy SoilMRLLVLLVRRLLGRRQPTPRPRPPADPERLQRIYRDTQRQVEELRRAA
Ga0207641_1181814723300026088Switchgrass RhizosphereMRLIRRLLSRRRPMLRAADPERLQRIYRETHRHVEELRRAA
Ga0207674_1184476213300026116Corn RhizosphereVRLVRLLFGPRRPMLRPADPARLQHIYRETHRHVERPALRGLTA
Ga0209027_102548523300026300Grasslands SoilMRVLRRLLRRRRPTPRPADPERLQRIYRETHRHVEELRRAA
Ga0209239_103151523300026310Grasslands SoilMRLLRRLLRRRPMARPADPERLQRIYRETHRHVEELRRAA
Ga0209801_107917723300026326SoilMRLLTRLVRRLLGRGRPPSRPTPPADPERLQRIYRETHRHVEDLRRAA
Ga0209473_117642213300026330SoilMRLFALLIRRRPAPRPRPPADPERLQQIYRETQRHVEDLRRAA
Ga0209156_1035380313300026547SoilMRVLRRLLHGRRPMPRPADPERLQRIYRETHRHVEELRRAA
Ga0209810_100970493300027773Surface SoilVRGSLLLLRLVRRLAGRRPPPASTPAADPERLQRVYRETRRRVERLRRAA
Ga0209811_1000936423300027821Surface SoilMKLIRRLLGRPRPMLHPADPERLQRIYRETHRHVEELRRAA
Ga0209465_1017883423300027874Tropical Forest SoilMKLIRRLLGRRKSAPRLLMLQADSERLQQIYRETHRQVEELRRAA
Ga0307497_1041350113300031226SoilLLRRRRPTPRPADPERLQRIYRETHRHVEELRRAA
Ga0307477_1012302133300031753Hardwood Forest SoilMRLLVLLIDRLLGRRRRPSPRPRSPHDPERLQRVYRETQRHVEELRRAA
Ga0308175_1000000151563300031938SoilMRLLVQVIRRLLGRRGRPAPRPTPPTDPERLHRIYRETHRHVEDLRRAA
Ga0308175_10106663923300031938SoilMKAVRRLLGRRGPVPRPRPPIDSERLERIYRETHRRMEELRR
Ga0308175_10316179123300031938SoilMRLVALLLGRRRPAQRPTPPADPERLQRIYRETQRHVEELRRAA
Ga0308174_10001912103300031939SoilVKLIRRLLARRRPTSSPADPERLQRIYHETHRRVEELRRAA
Ga0308174_1076613823300031939SoilMRLLARLIRRLLGRRRPAPRPVPPTDPERLQRIYRETHRQVEDLRRAA
Ga0335085_10048699103300032770SoilVKLFARLRHRLLGRRRPTPRSKLSADPERLQRIYRETQRHVEELRRAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.