NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072714

Metagenome / Metatranscriptome Family F072714

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072714
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 48 residues
Representative Sequence MTIQMPVDDKVLAADTQTTTPPLYQRVLIAVADADQVGPVVELARR
Number of Associated Samples 95
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.39 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.521 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(46.281 % of family members)
Environment Ontology (ENVO) Unclassified
(54.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(46.281 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.54%    β-sheet: 0.00%    Coil/Unstructured: 59.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF01381HTH_3 19.01
PF00196GerE 3.31
PF01244Peptidase_M19 0.83
PF04909Amidohydro_2 0.83
PF13560HTH_31 0.83
PF02423OCD_Mu_crystall 0.83
PF02558ApbA 0.83
PF13344Hydrolase_6 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.83
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.52 %
UnclassifiedrootN/A2.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0391411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300005180|Ga0066685_11003604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300005187|Ga0066675_10113006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1813Open in IMG/M
3300005436|Ga0070713_100951008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300005436|Ga0070713_101977661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300005569|Ga0066705_10274999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300005764|Ga0066903_105135682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300006028|Ga0070717_10372497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1279Open in IMG/M
3300006172|Ga0075018_10273472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300006175|Ga0070712_100319261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300006175|Ga0070712_100978938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300006804|Ga0079221_11526747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300006804|Ga0079221_11594225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006904|Ga0075424_101178595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria816Open in IMG/M
3300006954|Ga0079219_12272547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300009523|Ga0116221_1111116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1207Open in IMG/M
3300010046|Ga0126384_10648551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300010046|Ga0126384_12180239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300010047|Ga0126382_10006160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5450Open in IMG/M
3300010048|Ga0126373_12503496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300010048|Ga0126373_13323536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300010359|Ga0126376_11137796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300010360|Ga0126372_11690742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300010360|Ga0126372_13195068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300010361|Ga0126378_10481813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1355Open in IMG/M
3300010362|Ga0126377_11171585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria838Open in IMG/M
3300010371|Ga0134125_10816313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1026Open in IMG/M
3300010373|Ga0134128_12969213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300012971|Ga0126369_10612581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1160Open in IMG/M
3300013306|Ga0163162_10645180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300015374|Ga0132255_102377428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300016270|Ga0182036_11376136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300016319|Ga0182033_11140063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300016319|Ga0182033_11918619Not Available539Open in IMG/M
3300016357|Ga0182032_11120544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300016422|Ga0182039_11103188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300017943|Ga0187819_10018529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4026Open in IMG/M
3300017973|Ga0187780_10159950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1564Open in IMG/M
3300017995|Ga0187816_10409945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300017999|Ga0187767_10146680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300017999|Ga0187767_10255035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300018012|Ga0187810_10041673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1713Open in IMG/M
3300018058|Ga0187766_10817149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M
3300018433|Ga0066667_10792875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300021372|Ga0213877_10286694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300021478|Ga0210402_11183630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300024290|Ga0247667_1027632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300025915|Ga0207693_11006654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300025915|Ga0207693_11179641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300025928|Ga0207700_11190862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300025929|Ga0207664_11515127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300025949|Ga0207667_11982673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300026023|Ga0207677_10322377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1284Open in IMG/M
3300027787|Ga0209074_10427282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300027867|Ga0209167_10650653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300028379|Ga0268266_12194626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300028875|Ga0307289_10183496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300029636|Ga0222749_10811646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300031543|Ga0318516_10222439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1091Open in IMG/M
3300031544|Ga0318534_10275481Not Available970Open in IMG/M
3300031561|Ga0318528_10641232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300031561|Ga0318528_10657334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300031564|Ga0318573_10137296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300031640|Ga0318555_10632160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300031679|Ga0318561_10283052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300031679|Ga0318561_10512617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300031680|Ga0318574_10169496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1246Open in IMG/M
3300031681|Ga0318572_10579581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300031681|Ga0318572_10621088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300031682|Ga0318560_10638223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300031724|Ga0318500_10236800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300031736|Ga0318501_10224559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria988Open in IMG/M
3300031736|Ga0318501_10307652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300031736|Ga0318501_10644988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300031748|Ga0318492_10522172Not Available631Open in IMG/M
3300031764|Ga0318535_10425492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300031768|Ga0318509_10025327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2835Open in IMG/M
3300031771|Ga0318546_10164226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1503Open in IMG/M
3300031777|Ga0318543_10358610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300031792|Ga0318529_10497946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300031792|Ga0318529_10514467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300031793|Ga0318548_10099867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1388Open in IMG/M
3300031797|Ga0318550_10267153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300031797|Ga0318550_10271697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300031798|Ga0318523_10003723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5550Open in IMG/M
3300031798|Ga0318523_10280978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300031819|Ga0318568_10721011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300031823|Ga0307478_11153781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300031845|Ga0318511_10263000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300031846|Ga0318512_10579293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300031859|Ga0318527_10316379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300031879|Ga0306919_10772125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300031879|Ga0306919_11482874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300031880|Ga0318544_10371749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300031893|Ga0318536_10227315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300031893|Ga0318536_10679928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300031897|Ga0318520_10146217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1367Open in IMG/M
3300031897|Ga0318520_10362975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300031946|Ga0310910_10637296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300031947|Ga0310909_10444539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300031947|Ga0310909_10782053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300031954|Ga0306926_10487858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1515Open in IMG/M
3300031954|Ga0306926_10724878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1204Open in IMG/M
3300031954|Ga0306926_10885261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1070Open in IMG/M
3300031981|Ga0318531_10215057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300031981|Ga0318531_10567091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300032001|Ga0306922_10898275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300032001|Ga0306922_10935147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300032008|Ga0318562_10689122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300032039|Ga0318559_10133232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M
3300032042|Ga0318545_10373851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300032043|Ga0318556_10043519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2146Open in IMG/M
3300032052|Ga0318506_10411850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300032063|Ga0318504_10141542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300032065|Ga0318513_10375269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300032066|Ga0318514_10187883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300032180|Ga0307471_103100100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300032261|Ga0306920_100367912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2138Open in IMG/M
3300033289|Ga0310914_10077763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2809Open in IMG/M
3300033289|Ga0310914_10126022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2235Open in IMG/M
3300033290|Ga0318519_10912362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil46.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.31%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_039141113300000156Sugar Cane Bagasse Incubating BioreactorMTSKMPVDDKVLAGETQTTTQTAWQHALIAVADADQVGP
Ga0066685_1100360413300005180SoilMTIQMPVDHEVLAADMQTTTPPLYQRVLIAVADADQVGPVAELA
Ga0066675_1011300613300005187SoilMTSKMPVDEKVLAGDTQMTTDTQTTPQPAWQRALIAVADADQVGPVVELARRADVGEARVLHLNL
Ga0070713_10095100823300005436Corn, Switchgrass And Miscanthus RhizosphereMTIKMPADNKMLAANTQATTPPLYQRVLIAVADADQVGPVVELARRAGVREARVLH
Ga0070713_10197766113300005436Corn, Switchgrass And Miscanthus RhizosphereMTIQVPVGDEVLAAGMQTATPPLYQRVLIAVADADQVGPVVELARRAGV
Ga0066705_1027499913300005569SoilMTIQVPVDKEVLAADMQTTTPPLYQRVLIAVADADQVGPVVEL
Ga0066903_10513568223300005764Tropical Forest SoilMTSKMPVDDKVLAADTQTTTPPAWQRALIAVADADQVGPVVELARR
Ga0070717_1037249723300006028Corn, Switchgrass And Miscanthus RhizosphereMTIQMPVHDKVLAADTQTTTPPLYQRVLIAVADASQVGPVAELARRAGVREARVLHLNLRES
Ga0075018_1027347213300006172WatershedsMTIQVPVDKELLAADVQTATPPLYHRVLIAVADAD
Ga0070712_10031926113300006175Corn, Switchgrass And Miscanthus RhizosphereMTSKMPVDDKVLAGDTQNTTPPLYQRVLIAIADASQVGPIAELARRAGVREARVLHLNL
Ga0070712_10097893813300006175Corn, Switchgrass And Miscanthus RhizosphereMTIQMPADDKVLAADTQTTTPPLYQRVLIAVADADQVGPV
Ga0079221_1152674723300006804Agricultural SoilMTIQMPVHDKVLAADTQTTTPPLYQRVLIAVADASQVGPVAELARRAGVREARVLHLN
Ga0079221_1159422513300006804Agricultural SoilMTIQVPADNEALAAGMQTTTPPLYQRVLIAVADAGQVGPV
Ga0075424_10117859523300006904Populus RhizosphereMTIQVPVDEEVLAADMQTTTPPLYQRVLIAVADADQVGPVVELARRAGVREARVLHLNL
Ga0079219_1227254723300006954Agricultural SoilMTSKMPVDDKALAGDTQNTQNTTPPLYQRVLIAIADASQVGPTAELA
Ga0116221_111111613300009523Peatlands SoilMTIQMPVDDKVLAADTQTTTPPLYQRVLIAVADADQVGPVVELARR
Ga0126384_1064855113300010046Tropical Forest SoilMTIQTPARHTTPAAGTPTTTPPLYQRALLAVADADQVGPVVELARRAGV
Ga0126384_1218023923300010046Tropical Forest SoilMTSKMPVDEKVLADDTQTTTPPAYQRVLIAVADASQIGPVVELARRTGVGEARVLHLNLRES
Ga0126382_1000616013300010047Tropical Forest SoilMTIKMPVDDKVLAAQTQTTTPPLYQRVLIAVADAGQVGPVVELARRAGVREARVLHLN
Ga0126373_1250349623300010048Tropical Forest SoilMTIQMPAHEKVLAADTQTTTPPLYHRVLIAVADADQVGPVVELARRAG
Ga0126373_1332353613300010048Tropical Forest SoilMTIQMPVHDKVLSADTQTTTPPLYQRVLIAVADADQVGAVVELARRAGVREARVLHLNLR
Ga0126376_1113779623300010359Tropical Forest SoilMTIQMPVHDKVLSADTQTTTPPLYQRVLIAVADADQVGPVVELARRA
Ga0126372_1169074223300010360Tropical Forest SoilMTIQMPVDDKVLAADTQTTTPPLYQRVLIAVADADQVGPVVELARRAGVREARVLH
Ga0126372_1319506823300010360Tropical Forest SoilMTIKMPVDDKVLAAQTQTTTPPLYQRVLIAVADAGQVGPVV
Ga0126378_1048181323300010361Tropical Forest SoilMTSKMPVDEKVLEGDAHTTTPPAYKRALIAVADASQVGPLVELARRS
Ga0126377_1117158513300010362Tropical Forest SoilMTIKMPVDDKALAADTQTTTPPLYQRVLIAVADADQVGPVVELARLAGVREARVLHLNL
Ga0134125_1081631323300010371Terrestrial SoilMTIQVPVGDEVLAAGMQTATPPLYQRVLIAVADADQVGPVVELARRAGVRE
Ga0134128_1296921323300010373Terrestrial SoilMTIKMLAVNKMLAANTQATTPPLYQRVLIAVADAD
Ga0126369_1061258113300012971Tropical Forest SoilMTSKMVDEKVLADDTQTTTPPAYKRVLIAVADASQVGPVVELARRTGV
Ga0163162_1064518023300013306Switchgrass RhizosphereMTSKMPVDEKVLAGDTLTTTDTQTTTPPAWQRALIAVADADQVGPVVELARRA
Ga0132255_10237742813300015374Arabidopsis RhizosphereMTIQVPADDEVLEAGLPTTTPLLYQRVLIAVADADQVGPVVEL
Ga0182036_1137613613300016270SoilMTSTMPVDDKVLAVDTQIPAQTIYQRVLIAVADASQIGPVVELARR
Ga0182033_1114006323300016319SoilMTSTMPVDDKVLAVDTQTPTQPINQRVLIAVADASQVGPLVELARQAG
Ga0182033_1191861913300016319SoilMSSNTQMPVDDTAVAAGAQTTTPPLYQRVLIAVADAGQVGPAVELARQAGVREARALHLNLR
Ga0182032_1112054413300016357SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQV
Ga0182039_1110318813300016422SoilMTIQMPVDDKVLTADTQTTTPSLYQRVLIAVADAG
Ga0187819_1001852913300017943Freshwater SedimentMTIQLPAEDKVLAADAPPLYQRVLIAVADAEQVGPVV
Ga0187780_1015995023300017973Tropical PeatlandMTSKMPVDEKVLAEDTQPAYPRVLIAVADASQVGPVVELARRSGVGEARVLHL
Ga0187816_1040994523300017995Freshwater SedimentMTIHMPVDDKVLAADTQTTTPTLYQRVLIAVADAD
Ga0187767_1014668013300017999Tropical PeatlandMTSKMTVDEKVLAADPQTTTQPAYPRVLIAVADASQVGPVVELASRSGVGE
Ga0187767_1025503523300017999Tropical PeatlandMTSKMTVDDKVRAADTPTTTQPAYPRVLIAVADASQIGP
Ga0187810_1004167313300018012Freshwater SedimentMTIHLPAEDKVLAADAPPLYQRVLIAVADADQVGPVVE
Ga0187766_1081714923300018058Tropical PeatlandMTSKMPVDEKVLASDTQTTTPSLYQRVLIAVADASQ
Ga0066667_1079287523300018433Grasslands SoilMTSKMPVDEKVLAGDTQMTTDTQTTPQPAWQRALIAVADADQVGPVVELAR
Ga0213877_1028669413300021372Bulk SoilMTIQMPVHDKVLAADTQATTPPLYQRVLIAVADADQVGPVAELARRAGVREARVLHLNL
Ga0210402_1118363023300021478SoilMTSKMPVDDKVLATDTQTTTPPLYQRVLIAVADAGQVGPVVELARRAGVREASLL
Ga0247667_102763213300024290SoilMTSKMPVDDKVLVGETQNTTPPLYQRVLIAIADASQ
Ga0207693_1100665423300025915Corn, Switchgrass And Miscanthus RhizosphereMTIQMPADDKVLAADTQTTTPPLYQRVLIAVADADQVGPVVELAHRAGVRE
Ga0207693_1117964123300025915Corn, Switchgrass And Miscanthus RhizosphereMTIKMPADNKMLAANTQATTPPLYQRVLIAVADADQVGPV
Ga0207700_1119086223300025928Corn, Switchgrass And Miscanthus RhizosphereMTIKMPADNKMLAANTQATTPPLYQRVLIAVADADQVGPVVELARRAG
Ga0207664_1151512723300025929Agricultural SoilMTIQMPADDKVLAADTQTTTPPLYQRVLIAVADADQVGPVVELAHRAGVREARVLHLNLR
Ga0207667_1198267323300025949Corn RhizosphereMTSKMPVDEKAPAHETHITTQPTYQRALIAVADASQVGPVVELARRAGVG
Ga0207677_1032237713300026023Miscanthus RhizosphereMTSKMPVDDKVLVGETQNTTPPLYQRVLIAIADASQVGPVAELARRAGVREARVLHLNL
Ga0209074_1042728223300027787Agricultural SoilMTIQMPVDDTVLTADPQTETPPLCQRVLVAVADAGQVGPVVELARR
Ga0209167_1065065313300027867Surface SoilMTIQLPAEDKVLAADTPSLYQRVLIAVADADQVGPLVELARRAG
Ga0268266_1219462613300028379Switchgrass RhizosphereMTSKMPVDDKVLVGETQNTTPPLYQRVLIAIADASQVGPVAELARRAGGPAPL
Ga0307289_1018349613300028875SoilMTIQVPADDEVLEAGLQTTTPPLYQRVLIAVADADQVGPVVELARRAGVREARVLHLN
Ga0222749_1081164613300029636SoilMTIQMPVDHEVLAADMQTTTPPLYQRVLIAVADADQVGPV
Ga0318516_1022243913300031543SoilMTSKMPVDDKVLAGDAHTTTPTAYKRALIAVADASHVG
Ga0318534_1027548113300031544SoilMSSNTQMPVDDTAPAAGAQTTTPPLYQRVLIAVADAGQVGPAVELARQADAREARAAAEAPPGDPIWP
Ga0318528_1064123213300031561SoilMTSKMPVDEKVLATDTQTTTPPLYQRVLIAVADASQVGPVVELA
Ga0318528_1065733413300031561SoilMTIQMPVDDKVLTADTQITAPPLYQRVLIAVADAGQVGPVVELARRAGVREARVLHLN
Ga0318573_1013729613300031564SoilMTSKMPVDDKVLEGDAHTTTPPAYKRALIAVADASQVGPLVGL
Ga0318555_1063216013300031640SoilMTIQMPVDDKVLAADTPTTTPPLYQRVLITVADAGQVGPVVELARRAGVGEARV
Ga0318561_1028305213300031679SoilMTINMPVDDKALAADTQTTPRSLYQRVLIAVADASQVGPMVELAQRAGVGEARVLHLNL
Ga0318561_1051261723300031679SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVGPVVELA
Ga0318574_1016949613300031680SoilMTIQMPVDDRALTADPQITTPPLYQRVLIAVADAGQVG
Ga0318572_1057958123300031681SoilMTSKMPVDDKVLEGDAHTTTPPAYKRALIAVADASQVGPLVGLARRS
Ga0318572_1062108813300031681SoilMTINMPVDDKALAADSQTTTPTLYQRVLIAVADAGQVGPVV
Ga0318560_1063822323300031682SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVGPVVELARRAGVRE
Ga0318500_1023680013300031724SoilMTSKTPVDDKVLATDTQTTTPPLYQRVLIAVADAGQVGPAVELA
Ga0318501_1022455923300031736SoilMTSKMPVDEKVLASDTQTTTPTLYQRVLIAVADASQVGPVVELAR
Ga0318501_1030765223300031736SoilMTSKMPVDDKVLAGDAHTTTPTAYKRALIAVADASQVGPLVELA
Ga0318501_1064498813300031736SoilMTIQMPVDDRALTADPQITTPPLYQRVLIAVADAGQVGPVVERP
Ga0318492_1052217213300031748SoilMSSNTQMPVDDTAVAAGAQTTTPPLYQRVLIAVADAGQVGPAVELARQAGVRE
Ga0318535_1042549223300031764SoilMTSKMPVDDKVLAGDAHTTTPTAYKRALIAVADASQVG
Ga0318509_1002532743300031768SoilMTNTMPVDDKVLSDTETTTQPLNQRVLIAVADANQVGPMVELARRAGVREALV
Ga0318546_1016422613300031771SoilMTNTMPVDDKVLSDTETTTQPLNQRVLIAVADANQVGPMVELARRAGVREALVLHLN
Ga0318543_1035861023300031777SoilMTIQMPVDDKVLTADTQITAPPLYQRVLIAVADAGQVGPVVELARRAGVR
Ga0318529_1049794623300031792SoilMTNTMPVDDKVLSDTETTTQPLNQRVLIAVADANQVGP
Ga0318529_1051446713300031792SoilMTIQMPVDDKVLTADTQITAPPLYQRVLIAVADAGQVGPVVELARRAGVREARVLHLNLR
Ga0318548_1009986723300031793SoilMTIQMPVDDRALTADPQITTPPLYQRVLIAVADAGQVGPVVELARRAGVREARV
Ga0318550_1026715323300031797SoilMTNTMPVDDKVLSDTETTTQPLNQRVLIAVADANQVGPMVELAR
Ga0318550_1027169713300031797SoilMTSKMPVDDKVLATDTQTTTPPLYQRVLIAVADAGQVGP
Ga0318523_1000372373300031798SoilMTNTMPVDDKVLSDTETTTQPLNQRVLIAVADANQ
Ga0318523_1028097813300031798SoilMTIQMPVDDRALTADPQITTPPLYQRVLIAVADAGQVGPVVELARRAD
Ga0318568_1072101113300031819SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVG
Ga0307478_1115378123300031823Hardwood Forest SoilMTIQLPAEDKVLAADAPPLYQRVLIAVADADQVGPVVELARRAGVHEARVLHL
Ga0318511_1026300013300031845SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVGPVVELAR
Ga0318512_1057929323300031846SoilMTSKTPVDDKVLATDTQTTTPPLYQRVLIAVADAGQVGPVVELARRA
Ga0318527_1031637913300031859SoilMTSRMPVDDKVLAADTQTTTPTLYQRVLIAVADASQVGPVVELARRAGVREARVLH
Ga0306919_1077212513300031879SoilMTSKMPVDEKVLASDTQTTTPTLYQRVLIAVADASQVGPVVELA
Ga0306919_1148287423300031879SoilMTINMPVDDKALAADTQTATQPIYQRVLIAVADAGQVGPMVELARR
Ga0318544_1037174923300031880SoilMTSKMPVDEKVLATDTQTTTPPLYQRVLIAVADASQVGPVVELARRAGVREARV
Ga0318536_1022731523300031893SoilMTSKMPVDEKVLATDTQTTTPPLYQRVLIAVADASQVGPVVELAR
Ga0318536_1067992823300031893SoilMTINMPVDDKALAADTQTATQPIYQRVLIAVADAGQVGPMVELARRSGVG
Ga0318520_1014621713300031897SoilMTSTMPVDDKVLAVDTQTPTQPINQRVLIAVADASQIGPVVELA
Ga0318520_1036297513300031897SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVGPVVELARRAGVREARVLQLN
Ga0310910_1063729623300031946SoilMTSKMPVDDKVLEGDAHTTTPPAYKRALIAVADASQVGPLVGLARRSGVGEA
Ga0310909_1044453913300031947SoilMTSKMPVDEKVLASDTQTTTPTLYQRVLIAVADASQVGPVVELARRAGVREARVLHLNLR
Ga0310909_1078205323300031947SoilMTSKTPVDEKVLATDTQTTTPPLYQRVLIAVADASQVGPVVELARRAGVREARVLHLNLR
Ga0306926_1048785823300031954SoilMTSKMPVDEKVLASDTQTTTPTLYQRVLIAVADASQVGPVVELARRAGVREA
Ga0306926_1072487813300031954SoilMTIQMPVDDRALTADPQITTPPLYQRVLIAVADAGQV
Ga0306926_1088526113300031954SoilMTSKMPVDDKVLAGDAHTTTPTAYKRALIAVADASQVGPLVEL
Ga0318531_1021505723300031981SoilMTNTMPVDDKVLSDTETTTQPLNQRVLIAVADANQVGPMVELARRAGVREALVLHLNL
Ga0318531_1056709123300031981SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVGPVVELARRAGVREARV
Ga0306922_1089827523300032001SoilMTSKMPVDDKVLAGDAHTTTPTAYKRALIAVADASQVGPLV
Ga0306922_1093514723300032001SoilMTINMPVDDKALAADTQATPRSLYQRVLIAVADASQVGPM
Ga0318562_1068912223300032008SoilMTTQMPVDDKVLAGDTHATTPPLYQRVLIAVADADQVG
Ga0318559_1013323213300032039SoilMTSKMPVDDKVLAGDAHTTTPTAYKRALIAVADASQVGPLVELAR
Ga0318545_1037385123300032042SoilMTIQMPVDDKVLTADTQTTTPSLYQRVLIAVADAGQVGPVVELARRAGVREARVLHLNLR
Ga0318556_1004351943300032043SoilMTSKTPVDDKVLATDTQTTTPPLYQRVLIAVADAGQVGP
Ga0318506_1041185013300032052SoilMTSKMPVDEKVLATDTQTTTPPLYQRVLIAVADASQVGPVVELARRAGVREARVLH
Ga0318504_1014154223300032063SoilMTSKMPVDEKVLATDTQTTTPPLYQRVLIAVADAGQVGPVVELARRAGVRE
Ga0318513_1037526923300032065SoilMTIQMPVDDKVLTADTQTTTPSLYQRVLIAVADAGPT
Ga0318514_1018788323300032066SoilMTSKTPVDEKVLATDTQTTTPLLYQRVLIAVADAGQVGPVVELARRAGV
Ga0307471_10310010013300032180Hardwood Forest SoilMTIQVPVGDEVLAAGMPTTTPPLYQRVLIAVADAGQVGPVVELARRAGVREARVLHLNL
Ga0306920_10036791213300032261SoilMTSKTPVDDKVLATDTQTTTPPLYQRVLIAVADAGQVGPVVELARRAGVREARVLH
Ga0310914_1007776343300033289SoilMTSKMPVDDKVLEGDAHTTTPPAYKRALIAVADASQVGPLVGLARRSGVGEARVLH
Ga0310914_1012602213300033289SoilMTSTMPVDDKVLAVDTQTPTQPINQRVLIAVADASQIGPVVELARRAGVREARVLH
Ga0318519_1091236213300033290SoilMTSKTPVDSKVLAADTQTTTPPLYQRVLIAVADASQVGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.