Metagenome Family F072899

Basic Information
Family ID	F072899
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	40 residues
Representative Sequence	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Number of Associated Samples	20
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	45.00 %
% of genes from short scaffolds (< 2000 bps)	57.50 %
Associated GOLD sequencing projects	20
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Eukaryota (62.500 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (80.833 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (80.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF07727	RVT_2	2.50
PF13912	zf-C2H2_6	1.67
PF14291	DUF4371	1.67
PF13855	LRR_8	1.67
PF04844	Ovate	0.83
PF02892	zf-BED	0.83
PF00385	Chromo	0.83
PF00078	RVT_1	0.83
PF00665	rve	0.83
PF13952	DUF4216	0.83
PF02826	2-Hacid_dh_C	0.83
PF04450	BSP	0.83
PF04525	LOR	0.83
PF12643	MazG-like	0.83
PF00069	Pkinase	0.83
PF14223	Retrotran_gag_2	0.83
PF00125	Histone	0.83
PF14476	Chloroplast_duf	0.83
PF08615	RNase_H2_suC	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.33
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.83
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.83
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.83
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.83
COG4894	Putative phospholipid scramblase YxjI, Tubby2 superfamily	Lipid transport and metabolism [I]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.17 %
Unclassified	root	N/A	35.83 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.17 %
Unclassified	root	N/A	35.83 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	62.50 %
Unclassified	root	N/A	35.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.67 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	62.50 %
Unclassified	root	N/A	35.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.83 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	62.50 %
Unclassified	root	N/A	35.83 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.83 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	60.83 %
Unclassified	root	N/A	35.83 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.83 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	60.83 %
Unclassified	root	N/A	35.83 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	0.83 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	50.83 %
Unclassified	root	N/A	35.83 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	0.83 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	50.83 %
Unclassified	root	N/A	35.83 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	0.83 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	50.83 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	50.83 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	47.50 %
Unclassified	root	N/A	35.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	45.00 %
Unclassified	root	N/A	35.83 %
Euphorbiaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	2.50 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	43.33 %
Unclassified	root	N/A	35.83 %
Crotonoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	40.83 %
Unclassified	root	N/A	35.83 %
Micrandreae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae	0.83 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	35.00 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	1.67 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.83 %
Hevea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea	0.83 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.83 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.83 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	35.00 %
Populus tomentosa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	1.67 %
Hevea brasiliensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea → Hevea brasiliensis	0.83 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.83 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.83 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	0.83 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10011778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12090	Open in IMG/M
3300028786\|Ga0307517_10012778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	11483	Open in IMG/M
3300028786\|Ga0307517_10028782	Not Available	6601	Open in IMG/M
3300028786\|Ga0307517_10048907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4339	Open in IMG/M
3300028786\|Ga0307517_10084502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2670	Open in IMG/M
3300028786\|Ga0307517_10231765	Not Available	1107	Open in IMG/M
3300028786\|Ga0307517_10344657	Not Available	812	Open in IMG/M
3300028786\|Ga0307517_10459309	Not Available	657	Open in IMG/M
3300028786\|Ga0307517_10623432	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	528	Open in IMG/M
3300028794\|Ga0307515_10013568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15205	Open in IMG/M
3300028794\|Ga0307515_10027189	Not Available	9795	Open in IMG/M
3300028794\|Ga0307515_10045891	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	6696	Open in IMG/M
3300028794\|Ga0307515_10078803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4325	Open in IMG/M
3300028794\|Ga0307515_10082230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4169	Open in IMG/M
3300028794\|Ga0307515_10085092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4051	Open in IMG/M
3300028794\|Ga0307515_10138823	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2621	Open in IMG/M
3300028794\|Ga0307515_10143802	Not Available	2540	Open in IMG/M
3300028794\|Ga0307515_10148087	Not Available	2472	Open in IMG/M
3300028794\|Ga0307515_10160747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2292	Open in IMG/M
3300028794\|Ga0307515_10218365	Not Available	1731	Open in IMG/M
3300028794\|Ga0307515_10319118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1221	Open in IMG/M
3300028794\|Ga0307515_10364062	Not Available	1085	Open in IMG/M
3300028794\|Ga0307515_10496415	Not Available	831	Open in IMG/M
3300028794\|Ga0307515_10532390	Not Available	784	Open in IMG/M
3300030521\|Ga0307511_10013971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	7823	Open in IMG/M
3300030521\|Ga0307511_10056838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3052	Open in IMG/M
3300030521\|Ga0307511_10074475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	2446	Open in IMG/M
3300030521\|Ga0307511_10116836	Not Available	1670	Open in IMG/M
3300030521\|Ga0307511_10128610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1535	Open in IMG/M
3300030521\|Ga0307511_10149725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1343	Open in IMG/M
3300030521\|Ga0307511_10152688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1320	Open in IMG/M
3300030521\|Ga0307511_10171619	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1190	Open in IMG/M
3300030521\|Ga0307511_10269171	Not Available	799	Open in IMG/M
3300030521\|Ga0307511_10368292	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	607	Open in IMG/M
3300030521\|Ga0307511_10447211	Not Available	512	Open in IMG/M
3300030522\|Ga0307512_10273332	Not Available	816	Open in IMG/M
3300030522\|Ga0307512_10339002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	671	Open in IMG/M
3300030522\|Ga0307512_10398123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	580	Open in IMG/M
3300031456\|Ga0307513_10025535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6840	Open in IMG/M
3300031456\|Ga0307513_10087688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	3184	Open in IMG/M
3300031456\|Ga0307513_10100986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2908	Open in IMG/M
3300031456\|Ga0307513_10121626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2576	Open in IMG/M
3300031456\|Ga0307513_10179773	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1980	Open in IMG/M
3300031456\|Ga0307513_10197224	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1858	Open in IMG/M
3300031456\|Ga0307513_10211817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1768	Open in IMG/M
3300031456\|Ga0307513_10220475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1718	Open in IMG/M
3300031456\|Ga0307513_10345035	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1238	Open in IMG/M
3300031456\|Ga0307513_10447196	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1017	Open in IMG/M
3300031456\|Ga0307513_10508342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	921	Open in IMG/M
3300031456\|Ga0307513_10825230	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	633	Open in IMG/M
3300031507\|Ga0307509_10028943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	6153	Open in IMG/M
3300031507\|Ga0307509_10150345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2245	Open in IMG/M
3300031507\|Ga0307509_10202402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1820	Open in IMG/M
3300031507\|Ga0307509_10288410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1397	Open in IMG/M
3300031507\|Ga0307509_10297530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1364	Open in IMG/M
3300031507\|Ga0307509_10300006	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1355	Open in IMG/M
3300031507\|Ga0307509_10912828	Not Available	543	Open in IMG/M
3300031507\|Ga0307509_10945673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	527	Open in IMG/M
3300031616\|Ga0307508_10066184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3182	Open in IMG/M
3300031616\|Ga0307508_10119185	Not Available	2241	Open in IMG/M
3300031616\|Ga0307508_10245568	Not Available	1387	Open in IMG/M
3300031616\|Ga0307508_10260973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1327	Open in IMG/M
3300031616\|Ga0307508_10279552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	1262	Open in IMG/M
3300031616\|Ga0307508_10308573	Not Available	1174	Open in IMG/M
3300031616\|Ga0307508_10508851	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	799	Open in IMG/M
3300031649\|Ga0307514_10055872	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3032	Open in IMG/M
3300031649\|Ga0307514_10113553	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1911	Open in IMG/M
3300031649\|Ga0307514_10201197	Not Available	1251	Open in IMG/M
3300031649\|Ga0307514_10235826	Not Available	1102	Open in IMG/M
3300031649\|Ga0307514_10253304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1039	Open in IMG/M
3300031649\|Ga0307514_10253602	Not Available	1038	Open in IMG/M
3300031649\|Ga0307514_10282872	Not Available	947	Open in IMG/M
3300031649\|Ga0307514_10388161	Not Available	720	Open in IMG/M
3300031649\|Ga0307514_10429536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa	659	Open in IMG/M
3300031649\|Ga0307514_10443824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	641	Open in IMG/M
3300031649\|Ga0307514_10491897	Not Available	586	Open in IMG/M
3300031649\|Ga0307514_10523794	Not Available	555	Open in IMG/M
3300031730\|Ga0307516_10041489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4573	Open in IMG/M
3300031730\|Ga0307516_10172342	Not Available	1903	Open in IMG/M
3300031730\|Ga0307516_10247740	Not Available	1477	Open in IMG/M
3300031730\|Ga0307516_10380286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1073	Open in IMG/M
3300031730\|Ga0307516_10437089	Not Available	965	Open in IMG/M
3300031730\|Ga0307516_10556124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	801	Open in IMG/M
3300031730\|Ga0307516_10681177	Not Available	684	Open in IMG/M
3300031730\|Ga0307516_10813537	Not Available	596	Open in IMG/M
3300031730\|Ga0307516_10928349	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	538	Open in IMG/M
3300031838\|Ga0307518_10046263	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3164	Open in IMG/M
3300031838\|Ga0307518_10324191	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	917	Open in IMG/M
3300032354\|Ga0325403_1000656	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	25792	Open in IMG/M
3300032354\|Ga0325403_1015719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7043	Open in IMG/M
3300032354\|Ga0325403_1023144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5517	Open in IMG/M
3300032354\|Ga0325403_1023530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5454	Open in IMG/M
3300032354\|Ga0325403_1036669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3892	Open in IMG/M
3300032354\|Ga0325403_1046853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3129	Open in IMG/M
3300032354\|Ga0325403_1048199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea → Hevea brasiliensis	3041	Open in IMG/M
3300032354\|Ga0325403_1055117	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	2641	Open in IMG/M
3300032354\|Ga0325403_1061221	Not Available	2347	Open in IMG/M
3300032355\|Ga0325401_1064021	Not Available	2555	Open in IMG/M
3300032374\|Ga0325400_1276729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	627	Open in IMG/M
3300032389\|Ga0325405_1000194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	57175	Open in IMG/M
3300032389\|Ga0325405_1001134	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26785	Open in IMG/M
3300032389\|Ga0325405_1007080	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	11309	Open in IMG/M
3300032389\|Ga0325405_1020782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	5717	Open in IMG/M
3300032389\|Ga0325405_1033973	Not Available	3789	Open in IMG/M
3300032389\|Ga0325405_1064006	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1817	Open in IMG/M
3300032390\|Ga0325404_1027486	Not Available	4614	Open in IMG/M
3300032740\|Ga0325411_1022165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae	5713	Open in IMG/M
3300032741\|Ga0325414_1030617	Not Available	4581	Open in IMG/M
3300033179\|Ga0307507_10250351	Not Available	1145	Open in IMG/M
3300033179\|Ga0307507_10258364	Not Available	1115	Open in IMG/M
3300033179\|Ga0307507_10352154	Not Available	865	Open in IMG/M
3300033179\|Ga0307507_10471881	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	685	Open in IMG/M
3300033179\|Ga0307507_10633990	Not Available	545	Open in IMG/M
3300033180\|Ga0307510_10153834	Not Available	1911	Open in IMG/M
3300033180\|Ga0307510_10183025	Not Available	1655	Open in IMG/M
3300033180\|Ga0307510_10556092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	594	Open in IMG/M
3300034389\|Ga0325419_000368	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	47486	Open in IMG/M
3300034389\|Ga0325419_009291	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10402	Open in IMG/M
3300034389\|Ga0325419_009474	All Organisms → cellular organisms → Bacteria	10269	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	80.83%
Wood	Host-Associated → Plants → Wood	15.83%
Phylloplane	Host-Associated → Plants → Phylloplane	3.33%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	80.83%
Unclassified	Host-Associated → Plants → Wood → Unclassified	15.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	3.33%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	80.83%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	15.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	3.33%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	80.83%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	15.83%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	3.33%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated	Open in IMG/M
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100117781	3300028786	Ectomycorrhiza	MTFQSVGDFVCKEHQLTVQLGSEQFQSSLENTNGIFRW
Ga0307517_100127784	3300028786	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307517_100287825	3300028786	Ectomycorrhiza	MTFQSVTDFVRKEQQLTMQLESEQFWSSLENTDGKFRR
Ga0307517_100489071	3300028786	Ectomycorrhiza	MTFQSVGDFIRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307517_100845021	3300028786	Ectomycorrhiza	MIFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRW
Ga0307517_102317651	3300028786	Ectomycorrhiza	MTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFCDDEQCS
Ga0307517_103446571	3300028786	Ectomycorrhiza	APTTFQSVSDFIHKEQQLTVQLEGEQFWSSLENTDGKFCW
Ga0307517_104593091	3300028786	Ectomycorrhiza	LNFSENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDGKFRR
Ga0307517_106234321	3300028786	Ectomycorrhiza	NRQITPTTFQSVGDFVRKEQKLTVQLKSEQFWSSLENTDGNFRL
Ga0307515_100135684	3300028794	Ectomycorrhiza	MTFQSVGDFVRKEQQLTMQLESEQFWCSLENTDGKFRR
Ga0307515_1002718914	3300028794	Ectomycorrhiza	MTFQSVTDFVRKEQQLTMQLESEQFWSSLENTDGKFRQ
Ga0307515_100458913	3300028794	Ectomycorrhiza	MTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307515_100788034	3300028794	Ectomycorrhiza	GDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307515_100822301	3300028794	Ectomycorrhiza	DFSIRGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307515_100850921	3300028794	Ectomycorrhiza	TTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFRR
Ga0307515_101388232	3300028794	Ectomycorrhiza	MHFQSVGDFIRKEQQLTVQLESEQFWSSLKNTDGKFRR
Ga0307515_101438021	3300028794	Ectomycorrhiza	MTSQSVGDFVRKEQQLTVQLKSEQFWSSLENTNGFFRQ
Ga0307515_101480871	3300028794	Ectomycorrhiza	MTFQSVTDFVRKEQQLTMQLESEQFWSSLKNTDGKFRR
Ga0307515_101607471	3300028794	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFRS
Ga0307515_102183651	3300028794	Ectomycorrhiza	MTFQSVGDFVHKEQQLTVQLESEEFWSSLEKTDRKFFR
Ga0307515_103191181	3300028794	Ectomycorrhiza	ENRQITPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDGIFHRLFLL
Ga0307515_103640621	3300028794	Ectomycorrhiza	MNFQSVGDFVSKEQQLTVQLEGEQFWSSLENTDEKFRR
Ga0307515_104964151	3300028794	Ectomycorrhiza	CQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSMENTDGQFRR
Ga0307515_105323901	3300028794	Ectomycorrhiza	LNFLENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDGKFRR
Ga0307511_100139711	3300030521	Ectomycorrhiza	MNFQSVGDFVCKEQQLTVQLESEQFWSSLENIDGKFRR
Ga0307511_100568384	3300030521	Ectomycorrhiza	TPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307511_100744753	3300030521	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLESEQFWSSLENTDGNFRR
Ga0307511_101168361	3300030521	Ectomycorrhiza	MHFQSVCDFVRKEQQLTVQLESKQFWSSLKNIDGKFRR
Ga0307511_101286101	3300030521	Ectomycorrhiza	TPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307511_101497251	3300030521	Ectomycorrhiza	MNFQSVSDFVRKEQQLTVQLEGEQFWSSLENTDGKFRR
Ga0307511_101526882	3300030521	Ectomycorrhiza	CQITPTTFQSVSDFVRKEQQLTVQLESEQFWSFLENTDGKFRQ
Ga0307511_101716193	3300030521	Ectomycorrhiza	WIFSENCQITPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENADGIVRR
Ga0307511_102691711	3300030521	Ectomycorrhiza	SENRQITPMTFQSVGDFVRKEQQLTVQLESEQFWSSLDNTDGKFRW
Ga0307511_103682921	3300030521	Ectomycorrhiza	FQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307511_104141742	3300030521	Ectomycorrhiza	SENIQITPTTFQSLGDFVRKEQQLTVQLESEQFWSPLENTDRNSVGDSLCN
Ga0307511_104472112	3300030521	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307512_102733322	3300030522	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENSIGNY
Ga0307512_103390021	3300030522	Ectomycorrhiza	MTFQSVGNFVRKEQQLTVQLESKQFWSSLENTDGKFRR
Ga0307512_103981231	3300030522	Ectomycorrhiza	TPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307513_100255351	3300031456	Ectomycorrhiza	IFSENRQITPTTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307513_100876881	3300031456	Ectomycorrhiza	IFSENHQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307513_101009861	3300031456	Ectomycorrhiza	MTFQSVGDFVCKEKQLIVQLESEQFWSSLGNTDGQFRR
Ga0307513_101216262	3300031456	Ectomycorrhiza	MTFQSVGDFVCKEQQLTVQLESEQFWSSLKNTDGNFRR
Ga0307513_101797731	3300031456	Ectomycorrhiza	MIFQSVGDFVRKEQQLIVQLESEQFWSSLENTNRKFRR
Ga0307513_101972242	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEHFWSSLENTDRKFRR
Ga0307513_102118171	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307513_102204752	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGIFRR
Ga0307513_103450351	3300031456	Ectomycorrhiza	TTFQSVGDFVCKEQQLTVQLESEQFWSSLENTDGNFRR
Ga0307513_104471961	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDEKFRR
Ga0307513_105083421	3300031456	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQFESEQFWSSLENTDGNFRR
Ga0307513_108252301	3300031456	Ectomycorrhiza	NRQITPTTFQSVRDFVRKEQQFIVQLESEQFWSSLENTDGIFLR
Ga0307509_100289433	3300031507	Ectomycorrhiza	HQITPTTFQSVGDFIRKEQQLTVQLKSEQFWSSLENTDGKFPL
Ga0307509_101503451	3300031507	Ectomycorrhiza	QSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFRR
Ga0307509_102024021	3300031507	Ectomycorrhiza	TPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDGIFHRLFLL
Ga0307509_102884101	3300031507	Ectomycorrhiza	TFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307509_102975301	3300031507	Ectomycorrhiza	IFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDKNFHR
Ga0307509_103000062	3300031507	Ectomycorrhiza	MKILNQLNFFRNRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307509_109128281	3300031507	Ectomycorrhiza	ENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRKFRR
Ga0307509_109456731	3300031507	Ectomycorrhiza	LNFLENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDRKFRR
Ga0307508_100661843	3300031616	Ectomycorrhiza	ITPMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307508_101191851	3300031616	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESKQFWSSLENTDGKFRW
Ga0307508_102455682	3300031616	Ectomycorrhiza	MNFQSVGGFVHKEQQLTVQLKSEQFWSSLENTDGIFRW
Ga0307508_102609731	3300031616	Ectomycorrhiza	KTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDRKFRR
Ga0307508_102795523	3300031616	Ectomycorrhiza	SENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307508_103085731	3300031616	Ectomycorrhiza	ITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGF
Ga0307508_105088511	3300031616	Ectomycorrhiza	MIFQSVGDFVRKEQQLIVQLESEQFWSSLENTDGKFRW
Ga0307514_100558724	3300031649	Ectomycorrhiza	RQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKLRR
Ga0307514_101135532	3300031649	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESKQLWSSLENTDGKFRR
Ga0307514_102011971	3300031649	Ectomycorrhiza	ENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307514_102358261	3300031649	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGIFRR
Ga0307514_102533041	3300031649	Ectomycorrhiza	RQITPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENADGIVRR
Ga0307514_102536021	3300031649	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFRR
Ga0307514_102828722	3300031649	Ectomycorrhiza	TFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307514_103881611	3300031649	Ectomycorrhiza	MKILNQLNFFRNCQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSMENTDGQFR
Ga0307514_104295361	3300031649	Ectomycorrhiza	TFQSVGDFVRKEQQLIVQLESEQFWSSLENTDKKFRR
Ga0307514_104438241	3300031649	Ectomycorrhiza	TFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGNFRR
Ga0307514_104918971	3300031649	Ectomycorrhiza	TFQPVGDFVRKGQQLTMQLKSEQFLSSLKNTDGIFRR
Ga0307514_105237941	3300031649	Ectomycorrhiza	LNEKFKLIDFFSENRQITPMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307516_100414892	3300031730	Ectomycorrhiza	MTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFHR
Ga0307516_101723422	3300031730	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLKSEQFLSSLENTDGIFCR
Ga0307516_102477401	3300031730	Ectomycorrhiza	MTFQSVGDFFRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307516_103802861	3300031730	Ectomycorrhiza	SENRQITPTTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGNFRR
Ga0307516_104370891	3300031730	Ectomycorrhiza	MSFQSVSDFVRKEKQLTVQLESEQFWSSLENTDGIFRR
Ga0307516_105561241	3300031730	Ectomycorrhiza	FKNRQQLPTIFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDKNFHR
Ga0307516_106811771	3300031730	Ectomycorrhiza	TFQSVGDFVRKEQKLTVQLKSEQFWSSLENTDGNFCL
Ga0307516_108135371	3300031730	Ectomycorrhiza	ITPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDRQFRR
Ga0307516_109283491	3300031730	Ectomycorrhiza	FFSENRQITPMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307518_100462633	3300031838	Ectomycorrhiza	MTFQSVGDFVCKEQQLIVQLESEQFWSSLENTDRNFRR
Ga0307518_103241911	3300031838	Ectomycorrhiza	MIFQSVGDFVRKEQQLIVQLESELFWSSLENTDGKFRW
Ga0325403_10006568	3300032354	Xylem	MTFQSVSIFIRKEQQLTMQLESEQFWSSLENTGGKFRW
Ga0325403_10157194	3300032354	Xylem	MTFQPIGDFIRKEQQLIVQLESEQFWSSLENTDGIFRR
Ga0325403_10231445	3300032354	Xylem	MTFQSVGDFFRKEQQLTVQLESEQFWSSLENIDGKFRR
Ga0325403_10235304	3300032354	Xylem	MTFQSVGDFVCKEQQLTVQLKSEQFWSSLENTDGKFRR
Ga0325403_10366694	3300032354	Xylem	MTFQSVGDFVRKEQQLTVQLESKQFWSSLENTDRKFRR
Ga0325403_10468531	3300032354	Xylem	MTFQSVGDFVRKEQQLTLQLESEQFWSSLKNTDEKFHR
Ga0325403_10481993	3300032354	Xylem	MTFQSVGDFVRKEQQLTVQLEGEQFWSSLENTDGKFRR
Ga0325403_10551171	3300032354	Xylem	MNFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGF
Ga0325403_10612213	3300032354	Xylem	MTFQFVGDFVHKEQQLTVQLKSKQFWSSLEKTDGIFHR
Ga0325401_10640211	3300032355	Xylem	MTFQSVGDFVRKEQQLTMQLESEQFWSSLENIDGKFCR
Ga0325400_12767291	3300032374	Xylem	MTFQSVDDFVRQEQQLTVQLENEQFWSSLENTDGKFRR
Ga0325405_100019446	3300032389	Xylem	MAFQSVGDFFRKEQQLIVQLESEQFWSSLENIDGKFRR
Ga0325405_100113421	3300032389	Xylem	MTFQSVGDFVRKEQQLTLQLESEQFWSSLKNTDGKFHR
Ga0325405_10070806	3300032389	Xylem	MIFQSVGDFVRKEQQLTVQLESEQFWSSLENIERKFRQ
Ga0325405_10207824	3300032389	Xylem	MTFQSVGDFVCKEQQLIVQLKSKQFWSSLENTDGKFRR
Ga0325405_10339733	3300032389	Xylem	MTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGKFRK
Ga0325405_10640062	3300032389	Xylem	MTFQSVSDFIRKEQQLTLQVESEQFWSSLENTDRKFRRCFPL
Ga0325404_10274861	3300032390	Xylem	MTFQSVGDFVRKEQQLTMQLESEQFWSSLENIDGKFCL
Ga0325411_10221654	3300032740	Xylem	MTFQSVGDFVRKEQQLTVQLKSKQFWSSLENTDGKFRR
Ga0325414_10306174	3300032741	Leaf	MTFQSVDDFVHQEQQLTVQLENEQFWSSLENTDGKFRR
Ga0307507_102503511	3300033179	Ectomycorrhiza	RRLFNPSIFFRKEQQLTVQLESEQFWISLENTSGKFRR
Ga0307507_102583642	3300033179	Ectomycorrhiza	MTPTAFQSVGDFVRKEQQLTVQLEGEQFWSSLENTDGNFRR
Ga0307507_103521541	3300033179	Ectomycorrhiza	TTFQSVGDFVRKEQQLTVQLESEQFWSSLKNSDGKFRQIYRRTLPTE
Ga0307507_104718811	3300033179	Ectomycorrhiza	ITPTTVKSVGDFVHKEQQLIVQLESERFWSSLKNTDGKFRR
Ga0307507_106339901	3300033179	Ectomycorrhiza	MFSENRQITPTTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGQFRR
Ga0307510_101538342	3300033180	Ectomycorrhiza	MTFQSVGDFVRKEQQLTVQLESEQLWSSMENIYGKFRR
Ga0307510_101830252	3300033180	Ectomycorrhiza	MTFQSVGDFVCKEQKLTVQLESEQFWSSLENTDGNF
Ga0307510_105560921	3300033180	Ectomycorrhiza	SENRQITSTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFHR
Ga0325419_000368_23004_23120	3300034389	Leaf	MTFQSVSDFVRKEQELTVQLKSEQFWSSLENTDGKFRR
Ga0325419_009291_1267_1383	3300034389	Leaf	MTFQSIGDFVRKEQQLTVQLESEQFWSSLENTNGIFHR
Ga0325419_009474_8312_8428	3300034389	Leaf	MTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGKFHQ

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F072899

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign