Basic Information | |
---|---|
Family ID | F073365 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 42 residues |
Representative Sequence | CSRGVTLVELDGVAAADKIVTLRDDGLPHEVRVVLGTKPPA |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 93.33 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.500 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.167 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.833 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF05532 | CsbD | 37.50 |
PF01904 | DUF72 | 4.17 |
PF03358 | FMN_red | 4.17 |
PF02806 | Alpha-amylase_C | 3.33 |
PF01975 | SurE | 2.50 |
PF07043 | DUF1328 | 2.50 |
PF01168 | Ala_racemase_N | 1.67 |
PF00583 | Acetyltransf_1 | 1.67 |
PF11838 | ERAP1_C | 1.67 |
PF00196 | GerE | 0.83 |
PF00534 | Glycos_transf_1 | 0.83 |
PF00175 | NAD_binding_1 | 0.83 |
PF14235 | DUF4337 | 0.83 |
PF02811 | PHP | 0.83 |
PF03631 | Virul_fac_BrkB | 0.83 |
PF11964 | SpoIIAA-like | 0.83 |
PF13450 | NAD_binding_8 | 0.83 |
PF00069 | Pkinase | 0.83 |
PF12838 | Fer4_7 | 0.83 |
PF00487 | FA_desaturase | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 37.50 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 4.17 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 3.33 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 3.33 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.33 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 3.33 |
COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 2.50 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 2.50 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.83 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.83 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.50 % |
Unclassified | root | N/A | 7.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000793|AF_2010_repII_A001DRAFT_10067802 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300000955|JGI1027J12803_108716954 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300001333|A21PFW6_1216448 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300004643|Ga0062591_100439962 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1095 | Open in IMG/M |
3300005186|Ga0066676_10665991 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300005186|Ga0066676_11097935 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 524 | Open in IMG/M |
3300005289|Ga0065704_10618955 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300005295|Ga0065707_10032982 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300005327|Ga0070658_10070662 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
3300005446|Ga0066686_10271728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1148 | Open in IMG/M |
3300005450|Ga0066682_10404834 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300005456|Ga0070678_102018108 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300005544|Ga0070686_101519805 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005545|Ga0070695_100209313 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300005552|Ga0066701_10253316 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1089 | Open in IMG/M |
3300005553|Ga0066695_10254480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
3300005558|Ga0066698_10921937 | Not Available | 558 | Open in IMG/M |
3300005559|Ga0066700_10823853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
3300005568|Ga0066703_10707983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300005569|Ga0066705_10725854 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005574|Ga0066694_10461635 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300005586|Ga0066691_10576966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
3300005616|Ga0068852_102542981 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006791|Ga0066653_10443854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 662 | Open in IMG/M |
3300006797|Ga0066659_10548075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
3300006797|Ga0066659_10960644 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300007255|Ga0099791_10523868 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300009012|Ga0066710_101244228 | Not Available | 1154 | Open in IMG/M |
3300009100|Ga0075418_11776588 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 671 | Open in IMG/M |
3300009101|Ga0105247_11804411 | Not Available | 509 | Open in IMG/M |
3300009177|Ga0105248_10319691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1748 | Open in IMG/M |
3300010303|Ga0134082_10030767 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
3300010303|Ga0134082_10226391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 770 | Open in IMG/M |
3300010322|Ga0134084_10034246 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300010333|Ga0134080_10322179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
3300010360|Ga0126372_13057038 | Not Available | 519 | Open in IMG/M |
3300010364|Ga0134066_10422741 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010364|Ga0134066_10444714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 505 | Open in IMG/M |
3300010399|Ga0134127_13329352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 526 | Open in IMG/M |
3300012149|Ga0153941_1087674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herminiimonas → Herminiimonas arsenicoxydans | 505 | Open in IMG/M |
3300012180|Ga0153974_1058751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 848 | Open in IMG/M |
3300012198|Ga0137364_10523635 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300012202|Ga0137363_11495453 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300012205|Ga0137362_10746522 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300012205|Ga0137362_11526649 | Not Available | 555 | Open in IMG/M |
3300012205|Ga0137362_11722594 | Not Available | 514 | Open in IMG/M |
3300012210|Ga0137378_10471155 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300012212|Ga0150985_119439896 | Not Available | 557 | Open in IMG/M |
3300012351|Ga0137386_10070055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2446 | Open in IMG/M |
3300012351|Ga0137386_10427044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 954 | Open in IMG/M |
3300012356|Ga0137371_10252675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1376 | Open in IMG/M |
3300012915|Ga0157302_10056743 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1125 | Open in IMG/M |
3300012960|Ga0164301_11194493 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 611 | Open in IMG/M |
3300012972|Ga0134077_10296882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 678 | Open in IMG/M |
3300012976|Ga0134076_10508620 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300012977|Ga0134087_10757676 | Not Available | 521 | Open in IMG/M |
3300013296|Ga0157374_11923925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 617 | Open in IMG/M |
3300013297|Ga0157378_10447361 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300013306|Ga0163162_11544461 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300013306|Ga0163162_11717552 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300014166|Ga0134079_10110570 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300015356|Ga0134073_10091378 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300015372|Ga0132256_102503713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 618 | Open in IMG/M |
3300016319|Ga0182033_10045501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2931 | Open in IMG/M |
3300016319|Ga0182033_10198178 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1595 | Open in IMG/M |
3300016341|Ga0182035_11578003 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 592 | Open in IMG/M |
3300016357|Ga0182032_10896803 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 753 | Open in IMG/M |
3300016387|Ga0182040_10610095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 884 | Open in IMG/M |
3300018054|Ga0184621_10178716 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300018054|Ga0184621_10201642 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300018066|Ga0184617_1223484 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300018073|Ga0184624_10357779 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 653 | Open in IMG/M |
3300018081|Ga0184625_10310125 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300018431|Ga0066655_10616057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 732 | Open in IMG/M |
3300018468|Ga0066662_10061952 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2453 | Open in IMG/M |
3300018468|Ga0066662_12187403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
3300019868|Ga0193720_1044821 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300019878|Ga0193715_1014453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1704 | Open in IMG/M |
3300019885|Ga0193747_1035668 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300019997|Ga0193711_1033731 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300019999|Ga0193718_1103698 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300020006|Ga0193735_1134729 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300020018|Ga0193721_1004254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3728 | Open in IMG/M |
3300022756|Ga0222622_10012935 | All Organisms → cellular organisms → Bacteria | 4030 | Open in IMG/M |
3300023058|Ga0193714_1007526 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
3300025898|Ga0207692_11116143 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300025903|Ga0207680_10239483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1250 | Open in IMG/M |
3300025923|Ga0207681_10552740 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 948 | Open in IMG/M |
3300025932|Ga0207690_10403494 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300025936|Ga0207670_10599437 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 904 | Open in IMG/M |
3300026067|Ga0207678_10821057 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300026305|Ga0209688_1095352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 548 | Open in IMG/M |
3300026324|Ga0209470_1022039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3415 | Open in IMG/M |
3300026325|Ga0209152_10114511 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300026360|Ga0257173_1065802 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300026537|Ga0209157_1223619 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 772 | Open in IMG/M |
3300026537|Ga0209157_1381861 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300026547|Ga0209156_10422939 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300026550|Ga0209474_10747916 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300026557|Ga0179587_10637373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 702 | Open in IMG/M |
3300026867|Ga0207475_1015202 | Not Available | 515 | Open in IMG/M |
3300028380|Ga0268265_10446552 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1207 | Open in IMG/M |
3300028708|Ga0307295_10103276 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300028793|Ga0307299_10320013 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300028824|Ga0307310_10441810 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 650 | Open in IMG/M |
3300028878|Ga0307278_10086963 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1407 | Open in IMG/M |
3300030916|Ga0075386_12060206 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300031231|Ga0170824_100496877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 668 | Open in IMG/M |
3300031231|Ga0170824_128320909 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031446|Ga0170820_10021388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 654 | Open in IMG/M |
3300031446|Ga0170820_15767548 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300031474|Ga0170818_104632585 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031716|Ga0310813_10863214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 818 | Open in IMG/M |
3300031833|Ga0310917_10405567 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 927 | Open in IMG/M |
3300031833|Ga0310917_11050225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
3300031910|Ga0306923_11608176 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300032012|Ga0310902_10480274 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 807 | Open in IMG/M |
3300032059|Ga0318533_10574120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 827 | Open in IMG/M |
3300032205|Ga0307472_102507671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 524 | Open in IMG/M |
3300032421|Ga0310812_10034032 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1885 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.17% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012149 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ025 MetaG | Host-Associated | Open in IMG/M |
3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026867 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A001DRAFT_100678021 | 3300000793 | Forest Soil | LVELDGVAAADKIVTLHDDALSHQVRVVLGTKSPA* |
JGI1027J12803_1087169541 | 3300000955 | Soil | NPEHCSRGVTLVELDGVAAADKIVMLRNDALPHDVRVVLGTKPPT* |
A21PFW6_12164483 | 3300001333 | Permafrost | PDHCSRGVTLVELDGVAAADKIVTLRDDALPHEVRVLLGTKQPA* |
Ga0062591_1004399621 | 3300004643 | Soil | RGVVVTELDGVSAANNIVNLRDDGVSHEVRVVLGNKPPA* |
Ga0066676_106659911 | 3300005186 | Soil | PDHCSRGVTLVELDGIAVADKIVTLRDDTQPHEVRVVLGTKPSS* |
Ga0066676_110979351 | 3300005186 | Soil | HCARGVTLVELDGAAAADKIVMLRNDALPHEVRVVLGPKPPT* |
Ga0065704_106189553 | 3300005289 | Switchgrass Rhizosphere | VENPDHCSRGVILMELDGVSAADKTVRLCDDGLPHEVRVVLGNKPV* |
Ga0065707_100329824 | 3300005295 | Switchgrass Rhizosphere | NPDHCSHGVILMELDGVSLADKTVKLCDDGLPHEVRAVLGNKPPV* |
Ga0070658_100706621 | 3300005327 | Corn Rhizosphere | DQCSRGVVVTELDGVSAANNIVNLCDDGVSHEVRVVLGNKPPA* |
Ga0066686_102717281 | 3300005446 | Soil | NPDHCSHGVVLLEVDGIAVPDKIVTLRDDALDHEVRVVLGTKTPA* |
Ga0066682_104048341 | 3300005450 | Soil | ENPERCSRGVTLVELDGVVAADKIVRLRNDELPHEVRVVLGSKPPT* |
Ga0070678_1020181082 | 3300005456 | Miscanthus Rhizosphere | DHCCRGVVVTELDGVSAANNIVNLRDDGVSHEVRVVLGNKPPA* |
Ga0070686_1015198051 | 3300005544 | Switchgrass Rhizosphere | RGVVVTELDGVSAANNIVNLCDDGVSHEVRVVLGNKPPA* |
Ga0070695_1002093134 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ENPDHCSRGVIVMELDGVTVAGKAVKLSDDGLPHEVRVVLGNKPPA* |
Ga0066701_102533161 | 3300005552 | Soil | TLVELDGAAVADKIVMLRNDALPHEVRVVLGPKPPT* |
Ga0066695_102544801 | 3300005553 | Soil | CSRGVVLVEVDGIAVPDKIVTLRDDALGHEVRVVLGTKTAA* |
Ga0066698_109219371 | 3300005558 | Soil | LVELDGVVAADKIVTLRNDMLSHEVRVVLGTEPPA* |
Ga0066700_108238532 | 3300005559 | Soil | FQNTIYHIAVENADHCSRGVTLVELDGVGVADKIMTLRDDALPHEVRVVLGTKPPA* |
Ga0066703_107079831 | 3300005568 | Soil | CSRGVTLVELDGVAAADKIVTLRDDGLPHEVRVVLGTKPPA* |
Ga0066705_107258541 | 3300005569 | Soil | VELDGVAVADKIVTLRDDTLPHEVRVVLGIKPPA* |
Ga0066694_104616351 | 3300005574 | Soil | VENPDHCSHGVVLLEVDGIAVPDKIVTLRDDALDHEVRVVLGTKTLA* |
Ga0066691_105769662 | 3300005586 | Soil | CSRGVVLVEVDGIAVPDKIVTLRDDALRHEVRVVVGTKTSA* |
Ga0068852_1025429811 | 3300005616 | Corn Rhizosphere | LCSRGVIVMELDGVTVAGKAVKLSDDGLPHEVRVVLGNKPPA* |
Ga0066653_104438543 | 3300006791 | Soil | VLVEVDGIAVPDKIVTLRDDALGHEVRVVLGTKTPA* |
Ga0066659_105480753 | 3300006797 | Soil | HCSRGVVLVEVDGIAVPDKIVTLRDDALRHEVRVVLGTKTSA* |
Ga0066659_109606443 | 3300006797 | Soil | RGVILMELDRVSAADKTVRLCDDGLLHEVRVVLGNKPPVSG* |
Ga0099791_105238681 | 3300007255 | Vadose Zone Soil | LMELDGVSAADKTVRLCDDGLPHEVRVVLGNKPM* |
Ga0066710_1012442283 | 3300009012 | Grasslands Soil | AVENPVPCSSGVTLVEVDGIMVHAKIVTLRDDGLRHEKRVVLGT |
Ga0075418_117765883 | 3300009100 | Populus Rhizosphere | VILVELDGVSVADKTVKLYDDGLPHEVRVVLGNKPST* |
Ga0105247_118044111 | 3300009101 | Switchgrass Rhizosphere | NPDQCSRGAAEPEIDEVSAANNIVNLCDDGVSHEVRVVLGNKPPG* |
Ga0105248_103196911 | 3300009177 | Switchgrass Rhizosphere | TELDGVSAANNIVNLCDDGVSHEVRVVLGNKPPA* |
Ga0134082_100307671 | 3300010303 | Grasslands Soil | DHCSRGVALVEVDGIAVSDKIVTLRDDARPHEVRVVLGTEPVA* |
Ga0134082_102263913 | 3300010303 | Grasslands Soil | GVTLVEVDGIMVADKIVTLRDDGLRHEVRVVLGT* |
Ga0134084_100342461 | 3300010322 | Grasslands Soil | EHCSRGVTLVELDGVAAADKIVTLRDDALPHEVRVVLGIEPSE* |
Ga0134080_103221791 | 3300010333 | Grasslands Soil | IAVENPDHCSRGVTLVELDGIAVADKIVVLRDDALPHEVRVVLGTKPSA* |
Ga0126372_130570381 | 3300010360 | Tropical Forest Soil | PDHCSRGVILVELDGVSVADKTVRLRDDGLSHEVRVVLGNKPPV* |
Ga0134066_104227411 | 3300010364 | Grasslands Soil | YRIVVENPYHCSRGVTLGKLDGVAARDKIVRLRDDALPHDVRVVLGTKPPT* |
Ga0134066_104447142 | 3300010364 | Grasslands Soil | ILVELDGVSTAEKTVGLCDDGLSHEVRVVLGNKPPVSG* |
Ga0134127_133293522 | 3300010399 | Terrestrial Soil | ILVELDGVSVADKIVKLRDDGQAHEVRVVMGNKPST* |
Ga0153941_10876741 | 3300012149 | Attine Ant Fungus Gardens | IAVENPDHCSHGVVLLEVDGIAVPDKIVTLRDDALDHEVRVVLGTKTPA* |
Ga0153974_10587512 | 3300012180 | Attine Ant Fungus Gardens | AVENPEHCSRGVTLVEVDGVAAADKIGILRNDALPHDVRVVLGAKPT* |
Ga0137364_105236352 | 3300012198 | Vadose Zone Soil | LVELDGVAAADKIVTLRDDALPHEVRVVLGIEPSE* |
Ga0137363_114954531 | 3300012202 | Vadose Zone Soil | ENPRHCSCGVTLLEVDGITVAEKMVTLRDDALPHEVRVVMGRESPDD* |
Ga0137362_107465221 | 3300012205 | Vadose Zone Soil | IYRIAVENPDHCSRGVTLVELDAGVAADKIVTLRDDALAHEVRVVLGTKPPA* |
Ga0137362_115266491 | 3300012205 | Vadose Zone Soil | NTTYRIAVENPDHCSQGVILMELDGISAADKIVRLCDDGLPHKVRVVLGNKPPV* |
Ga0137362_117225941 | 3300012205 | Vadose Zone Soil | ENPDHCSHGVVLLEVDGIAVPDKIVTLRDDALDHEVRAVLGTKTPA* |
Ga0137378_104711551 | 3300012210 | Vadose Zone Soil | RSQGVALVELDGVAVADKIVTLRDDTLPHEVRVVLGIKPPA* |
Ga0150985_1194398962 | 3300012212 | Avena Fatua Rhizosphere | GVVVTEVDGVSVANHIVKLCDDGVSHEVRVVLGNKPPA* |
Ga0137386_100700551 | 3300012351 | Vadose Zone Soil | RGVTLVELDGAAAADKIVMLRNDALPHEVRVVLGPKPPT* |
Ga0137386_104270441 | 3300012351 | Vadose Zone Soil | DHCSRGVTLVELDGIAVADKIVTLRDDALPHEVRVVLGTKPST* |
Ga0137371_102526751 | 3300012356 | Vadose Zone Soil | PLPCSSGVTLVEVDGIMVADKIVTLRDDGLRHEVRVVLGT* |
Ga0157302_100567434 | 3300012915 | Soil | VVVTELDEVSTANNTVKLCDDGMPHEVRVVLGNKPPA* |
Ga0164301_111944932 | 3300012960 | Soil | VLMELDGVAVADKIVTLRDDALPHEVRVVLGTKPST* |
Ga0134077_102968821 | 3300012972 | Grasslands Soil | VENPDHCSRGVALVEVDGIAVADKMVTLRDDARPHEVRVVLGTEPVV* |
Ga0134076_105086202 | 3300012976 | Grasslands Soil | LMELDGVSAADKTVKLCDGGLPHEVRVVLGNKPPV* |
Ga0134087_107576761 | 3300012977 | Grasslands Soil | IAVENPDQCSQGVILMELDGVSVADKIVRLCDDGLPHKVRVVLGNKPSL* |
Ga0157374_119239251 | 3300013296 | Miscanthus Rhizosphere | TELDGVSTANNTVKLCDDGMPHEVRVVLGNKPPA* |
Ga0157378_104473611 | 3300013297 | Miscanthus Rhizosphere | RGVIVMELDGVTVAGKAVKLSDDGLPHEVRVVLGNKPPA* |
Ga0163162_115444612 | 3300013306 | Switchgrass Rhizosphere | TVENPDRCSRGVVLVELDGVATVDKTVTLRNDALPHEVRVVLGIKPPDLDG* |
Ga0163162_117175521 | 3300013306 | Switchgrass Rhizosphere | RFAVENPDCCSRGVILVELDGVSVADKIVKLRDDGQTHEVRVVMGNKPST* |
Ga0134079_101105702 | 3300014166 | Grasslands Soil | IYHIGVENPDHCSRGVALVELDGAAVADKIVTLHDDAQPHGVRVVLGANPSA* |
Ga0134073_100913783 | 3300015356 | Grasslands Soil | VELDGVAAADKIVTLRDDALSHEVRVVLGTKPSTRGF* |
Ga0132256_1025037132 | 3300015372 | Arabidopsis Rhizosphere | VILLEVDGVSTADKKIKLLDDGQTHEVRVVLGNKPV* |
Ga0182033_100455011 | 3300016319 | Soil | ENPDNCSRGVILLEVDGVSTADKKIKLLDDGQTHEVRVVLGNKPA |
Ga0182033_101981781 | 3300016319 | Soil | PDHCSRGVTLVELDGVSVTDKVVKLRNDGLTHQVRVVLGRKLPS |
Ga0182035_115780031 | 3300016341 | Soil | CSRGVILLEVDGVSTADKKIKLLDDGQTHEVRVVLGNKPA |
Ga0182032_108968031 | 3300016357 | Soil | GVILLEVDGVSTADKKIKLLDDGQTHEVRVVLGNKPA |
Ga0182040_106100951 | 3300016387 | Soil | VENPDNCSRGVILLEVDGVSTADKKIKLLDDGQTHEVRVVLGNKPA |
Ga0184621_101787162 | 3300018054 | Groundwater Sediment | QNTLYRIAVENPGHCSSGVTLVEVDGIAVADKMVTLRDDSLPHEVRVVLGTESLA |
Ga0184621_102016421 | 3300018054 | Groundwater Sediment | PDHSSRGVTLVELDGVAAADKIVILRDDALPHEVRVVLGTKPPE |
Ga0184617_12234841 | 3300018066 | Groundwater Sediment | RGVIVMELDGVPAADKTVRLRDDGLPHEVRVVLGNKTPV |
Ga0184624_103577793 | 3300018073 | Groundwater Sediment | VILMESDGVSAADKPVKLCDDGLPHEVRVVLGNKPPM |
Ga0184625_103101251 | 3300018081 | Groundwater Sediment | CSLVVIVMKLDGVSAADKTVKLCDDGLPHEVRVVLGNKPPV |
Ga0066655_106160572 | 3300018431 | Grasslands Soil | CSRGVVVVELDGVAAADKIVTLRDDALSHEVRVVLGTKPST |
Ga0066662_100619521 | 3300018468 | Grasslands Soil | DHCSRGVTLVELDGVAAADKIVTLRDDALPHEVRVVLGTKSPP |
Ga0066662_121874031 | 3300018468 | Grasslands Soil | PCSRGVTLVELDGVASADKVITLRDDALPHEMRVVLGIEPPKK |
Ga0193720_10448211 | 3300019868 | Soil | TLVELDGIVAAGKIVTLRNDMLSHEVRVVLGTKPPT |
Ga0193715_10144531 | 3300019878 | Soil | NPDHCSRGVIVMELDGVSAADKTVKLFDDGLPHEVRVVLGNKPV |
Ga0193747_10356683 | 3300019885 | Soil | PDHCSRGVTLVELDGIAVADKIVTLRDDALLHEVRVVLGTKPPA |
Ga0193711_10337311 | 3300019997 | Soil | DHCSGGVILMELDGVSAAEKTVKLCDDGLSHEVRVVLGNKPV |
Ga0193718_11036982 | 3300019999 | Soil | SRGVILVELDGVSAAGKTVRLCDDGLSHEVRVVLGNKPV |
Ga0193735_11347291 | 3300020006 | Soil | IAVENPDHCSRGVILMELDGVSAANKTVRLCDDGLSHKIRVVLGNKPI |
Ga0193721_10042546 | 3300020018 | Soil | CSEGVVLMELDGVAVADKIVTLRDDALPHEVRVVLGTKPST |
Ga0222622_100129355 | 3300022756 | Groundwater Sediment | TVYHIAVENPDHCSRGVTLVELDGVPAADKIVTLRDDALPHDVRVVLGITPSA |
Ga0193714_10075263 | 3300023058 | Soil | CGGVVLVELDGVAAADKIVALRNDALHHEVRVVLGSKPAM |
Ga0207692_111161431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVTLMELDGVAAAEKIVTLRDDALLHEVRVVLGTEPAA |
Ga0207680_102394831 | 3300025903 | Switchgrass Rhizosphere | GVVVTELDGVSAANNIVNLCDDGVSHEVRVVLGNKPPA |
Ga0207681_105527401 | 3300025923 | Switchgrass Rhizosphere | DQCSRGVVVTELDGVSAANNIVNLCDDGVSHEVRVVLGNKPPA |
Ga0207690_104034942 | 3300025932 | Corn Rhizosphere | PDHCSRGVVLVELDGVATADKTVTLRNDALPHEVRVVLGIKPPDLDG |
Ga0207670_105994373 | 3300025936 | Switchgrass Rhizosphere | DHCCRGVVVTELDGVSAANNIVNLRDDGVSHEVRVVLGNKPPA |
Ga0207678_108210573 | 3300026067 | Corn Rhizosphere | RGVIVMELDGVTVAGKAAKLSDDGLPHEVRVVLGNKPPA |
Ga0209688_10953522 | 3300026305 | Soil | SRGVTLVELDGVAAADKIVTLRDDALPHEVRVVLGTEPPA |
Ga0209470_10220397 | 3300026324 | Soil | PDHCSRGVTLVELDGIAVADKIVTLRDDALPHEVRVVLGTKPSL |
Ga0209152_101145113 | 3300026325 | Soil | LVEVDEVLAADKTVRLRDDGLPHEVRVVLGNKPPV |
Ga0257173_10658021 | 3300026360 | Soil | RGVTLVELDGVAALDKIVRLRDDALPHDVRVVLGTKPPT |
Ga0209157_12236193 | 3300026537 | Soil | SGVTLVEVDGIMVANKIVTLRDDGLRHEVRVVLGT |
Ga0209157_13818612 | 3300026537 | Soil | VENPVHCSSGVTLVEVDGITVADKIVTLRDDALRHEVRVVLGT |
Ga0209156_104229392 | 3300026547 | Soil | QNTLYRIAVENPVHCSSGVTLVEIDGIAVADKIVRLRDDALPHEVRVVLGMEPQT |
Ga0209474_107479161 | 3300026550 | Soil | DHCSRGVTLVELDGVAVADKIVTLRDDALPHEVRVVLGTKPPS |
Ga0179587_106373733 | 3300026557 | Vadose Zone Soil | GVILMELDGVSAVDKTVTLCDDGLPHEVRVVLGNKPV |
Ga0207475_10152021 | 3300026867 | Soil | RGVIVMELDGVSVADKTMKLCDDGLPHEVRVVLGNKPPA |
Ga0268265_104465522 | 3300028380 | Switchgrass Rhizosphere | SRGVVLVELDGVAATDKIVTLRNDALPHEVRVVLGIKPPDLDG |
Ga0307295_101032761 | 3300028708 | Soil | TTYRMAVENPDHCSRGVILMELDGVSAADKTVRLCDDGLFHEVRVVLGNKPM |
Ga0307299_103200132 | 3300028793 | Soil | YSIAVENPDHCSRGVTLVELDGVPAADKIVTLRDDALPHDVRVVLGITPSA |
Ga0307310_104418103 | 3300028824 | Soil | ENPDHCSRGVVVMELDGASAADKTVRLSDDGLPHEVRVVMGSKAAV |
Ga0307278_100869631 | 3300028878 | Soil | EGVVLMELDGVAVADKIVTLRDDALPHEVRVVLGTKPST |
Ga0075386_120602062 | 3300030916 | Soil | VENPDHCSRGVMLMELDGVSAADKTVKLCDDGLPHEVRVVLGNIPPV |
Ga0170824_1004968771 | 3300031231 | Forest Soil | PDHCSRGVIVMELDGVSAGDKTVKLCDDGLPHEVRVVLGNKPPV |
Ga0170824_1283209091 | 3300031231 | Forest Soil | PDRCSRGVILMELDGVSAADKTVKLCDDGLPHDVRVVLGNKPPV |
Ga0170820_100213881 | 3300031446 | Forest Soil | RGVILMELDGVSTAYKTVRLRDDGLPHEVRVVLGNKPPV |
Ga0170820_157675484 | 3300031446 | Forest Soil | SRGVTVMELDGVSAAEKTVKLCDDGLPHEVRVVLGNKPPV |
Ga0170818_1046325851 | 3300031474 | Forest Soil | LVELDGVAAADEIVTLRNDSLPHEVRVVLGIKLPT |
Ga0310813_108632142 | 3300031716 | Soil | IENPDHCSRGVTLVELDGVVAADKIVTLRNDMLSHEVRVVLGTKPPT |
Ga0310917_104055671 | 3300031833 | Soil | RGVILLEVDGVSTADKKIKLRDDGQTHEVRVVLGNKPA |
Ga0310917_110502252 | 3300031833 | Soil | EHCSRGVTLLELDGVAVADKLVTLRDDALSHQVRVVLGTKSPA |
Ga0306923_116081761 | 3300031910 | Soil | QMELDGVSVTDKTVRLRDDGLPHEIRVVLGNKPPM |
Ga0310902_104802741 | 3300032012 | Soil | NPDHCSRGVIVMELDGVSAADNTVRLSDDGLPHEVRVVLGNKPPA |
Ga0318533_105741201 | 3300032059 | Soil | RGVILLEVDGVSTADKKIKLLDDGQTHEVRVVLGNKPA |
Ga0307472_1025076712 | 3300032205 | Hardwood Forest Soil | NPEDCSRGVTLVELDGIAVADKIVTLRDDALPHEVRVVLGTKPST |
Ga0310812_100340321 | 3300032421 | Soil | HISVENPEHCSSGVVVTTVDGVSAADDVVNLSDDGVQHEVRVVLGNKPRA |
⦗Top⦘ |