NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073523

Metagenome / Metatranscriptome Family F073523

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073523
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 48 residues
Representative Sequence MTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSASHSQAPRRKGR
Number of Associated Samples 96
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.83 %
% of genes near scaffold ends (potentially truncated) 28.33 %
% of genes from short scaffolds (< 2000 bps) 92.50 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(49.167 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(66.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.68%    β-sheet: 0.00%    Coil/Unstructured: 51.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF03733YccF 64.17
PF07510DUF1524 12.50
PF11716MDMPI_N 8.33
PF01807zf-CHC2 1.67
PF13662Toprim_4 1.67
PF00723Glyco_hydro_15 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3304Uncharacterized membrane protein YccF, DUF307 familyFunction unknown [S] 64.17
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 1.67
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.67 %
UnclassifiedrootN/A48.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_10390110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales902Open in IMG/M
3300002568|C688J35102_118194154Not Available537Open in IMG/M
3300004081|Ga0063454_100333610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales972Open in IMG/M
3300004153|Ga0063455_101257602Not Available560Open in IMG/M
3300005327|Ga0070658_10515198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1034Open in IMG/M
3300005329|Ga0070683_100610948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1044Open in IMG/M
3300005337|Ga0070682_100042758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2799Open in IMG/M
3300005338|Ga0068868_100082418All Organisms → cellular organisms → Bacteria2580Open in IMG/M
3300005338|Ga0068868_100799669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales851Open in IMG/M
3300005339|Ga0070660_100351042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1215Open in IMG/M
3300005341|Ga0070691_10970612Not Available528Open in IMG/M
3300005354|Ga0070675_101179740Not Available705Open in IMG/M
3300005455|Ga0070663_101267061Not Available650Open in IMG/M
3300005455|Ga0070663_101451568Not Available609Open in IMG/M
3300005457|Ga0070662_101623841Not Available558Open in IMG/M
3300005459|Ga0068867_100802028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300005564|Ga0070664_100373548Not Available1300Open in IMG/M
3300005616|Ga0068852_101102953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales814Open in IMG/M
3300005618|Ga0068864_100808138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales922Open in IMG/M
3300005718|Ga0068866_11342151Not Available521Open in IMG/M
3300005834|Ga0068851_10353418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales856Open in IMG/M
3300006573|Ga0074055_11488463Not Available709Open in IMG/M
3300006575|Ga0074053_11956274Not Available716Open in IMG/M
3300006755|Ga0079222_10327560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1019Open in IMG/M
3300006846|Ga0075430_100136773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2041Open in IMG/M
3300006853|Ga0075420_101932590Not Available504Open in IMG/M
3300006854|Ga0075425_100113862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3085Open in IMG/M
3300006904|Ga0075424_100919472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales933Open in IMG/M
3300009094|Ga0111539_10482247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1444Open in IMG/M
3300009098|Ga0105245_10593719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1133Open in IMG/M
3300009098|Ga0105245_11486507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300009098|Ga0105245_12089092Not Available620Open in IMG/M
3300009148|Ga0105243_10578912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum1077Open in IMG/M
3300009156|Ga0111538_11403037Not Available881Open in IMG/M
3300009545|Ga0105237_10840214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria925Open in IMG/M
3300009545|Ga0105237_12494845Not Available527Open in IMG/M
3300009551|Ga0105238_13002162Not Available507Open in IMG/M
3300009553|Ga0105249_11178545Not Available837Open in IMG/M
3300009553|Ga0105249_11372996Not Available778Open in IMG/M
3300009553|Ga0105249_11569662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300009553|Ga0105249_12658484Not Available573Open in IMG/M
3300009553|Ga0105249_13205568Not Available526Open in IMG/M
3300010375|Ga0105239_11795437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300010395|Ga0058701_10720321Not Available547Open in IMG/M
3300011107|Ga0151490_1022963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1421Open in IMG/M
3300012212|Ga0150985_120793747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300012469|Ga0150984_103799832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae975Open in IMG/M
3300012482|Ga0157318_1002398Not Available1016Open in IMG/M
3300012498|Ga0157345_1008573Not Available857Open in IMG/M
3300012501|Ga0157351_1037002All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012898|Ga0157293_10228911Not Available577Open in IMG/M
3300012906|Ga0157295_10113294Not Available763Open in IMG/M
3300012951|Ga0164300_10549302Not Available671Open in IMG/M
3300012961|Ga0164302_10887967Not Available683Open in IMG/M
3300013102|Ga0157371_11443012Not Available535Open in IMG/M
3300013105|Ga0157369_11896819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter605Open in IMG/M
3300013105|Ga0157369_12331627Not Available542Open in IMG/M
3300013306|Ga0163162_12626715Not Available579Open in IMG/M
3300014745|Ga0157377_10234368Not Available1182Open in IMG/M
3300015200|Ga0173480_11131995Not Available524Open in IMG/M
3300015371|Ga0132258_13577800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1063Open in IMG/M
3300018073|Ga0184624_10314215Not Available702Open in IMG/M
3300018422|Ga0190265_10945953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300018422|Ga0190265_11287123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia848Open in IMG/M
3300018432|Ga0190275_10021169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia5051Open in IMG/M
3300018432|Ga0190275_10550293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1195Open in IMG/M
3300018432|Ga0190275_10591524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum1156Open in IMG/M
3300018466|Ga0190268_10028425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1944Open in IMG/M
3300018469|Ga0190270_11957886Not Available644Open in IMG/M
3300018476|Ga0190274_10743667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1031Open in IMG/M
3300018920|Ga0190273_10347168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum1017Open in IMG/M
3300020081|Ga0206354_10417334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum978Open in IMG/M
3300020082|Ga0206353_10439033Not Available764Open in IMG/M
3300025321|Ga0207656_10334088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia754Open in IMG/M
3300025899|Ga0207642_10072030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1648Open in IMG/M
3300025901|Ga0207688_10060476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2134Open in IMG/M
3300025901|Ga0207688_10188433Not Available1233Open in IMG/M
3300025908|Ga0207643_10023243All Organisms → cellular organisms → Bacteria3418Open in IMG/M
3300025909|Ga0207705_10833340Not Available715Open in IMG/M
3300025919|Ga0207657_10281645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium ramosum1320Open in IMG/M
3300025920|Ga0207649_10590515Not Available853Open in IMG/M
3300025927|Ga0207687_10469262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae1046Open in IMG/M
3300025927|Ga0207687_11468336Not Available586Open in IMG/M
3300025940|Ga0207691_10528721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300025961|Ga0207712_11471998Not Available610Open in IMG/M
3300025981|Ga0207640_10090686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2116Open in IMG/M
3300025981|Ga0207640_11969859Not Available529Open in IMG/M
3300025986|Ga0207658_11297969Not Available666Open in IMG/M
3300026023|Ga0207677_10076364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2385Open in IMG/M
3300026023|Ga0207677_10260480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300026067|Ga0207678_11419462Not Available613Open in IMG/M
3300026089|Ga0207648_11041566Not Available767Open in IMG/M
3300026142|Ga0207698_10533331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1147Open in IMG/M
3300026142|Ga0207698_10649263Not Available1045Open in IMG/M
3300027809|Ga0209574_10234054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300028379|Ga0268266_11379411Not Available680Open in IMG/M
3300028589|Ga0247818_10692036Not Available706Open in IMG/M
3300028589|Ga0247818_11048506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300028592|Ga0247822_10131471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1828Open in IMG/M
3300028597|Ga0247820_11284194Not Available530Open in IMG/M
3300028754|Ga0307297_10030763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1576Open in IMG/M
3300028812|Ga0247825_10386149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300028812|Ga0247825_10435080Not Available929Open in IMG/M
3300028812|Ga0247825_10522532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300028812|Ga0247825_11445474Not Available504Open in IMG/M
3300028889|Ga0247827_11300345Not Available509Open in IMG/M
3300030336|Ga0247826_10868181Not Available710Open in IMG/M
3300030336|Ga0247826_11033581Not Available654Open in IMG/M
3300031547|Ga0310887_10507050Not Available727Open in IMG/M
3300031854|Ga0310904_10447440Not Available856Open in IMG/M
3300031996|Ga0308176_10559277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae1170Open in IMG/M
3300032013|Ga0310906_11117132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300032075|Ga0310890_10149636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae1542Open in IMG/M
3300032075|Ga0310890_11663816Not Available529Open in IMG/M
3300032080|Ga0326721_10124355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300032211|Ga0310896_10949778Not Available500Open in IMG/M
3300033551|Ga0247830_10799526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300034007|Ga0334936_018573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp.1486Open in IMG/M
3300034024|Ga0334927_058814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1044Open in IMG/M
3300034666|Ga0314788_143052Not Available577Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil16.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere8.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere7.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.67%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.67%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.83%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012482Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034007Biocrust microbial communities from Mojave Desert, California, United States - 32SMCEnvironmentalOpen in IMG/M
3300034024Biocrust microbial communities from Mojave Desert, California, United States - 23HNCEnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_1039011013300001686SoilTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR*
C688J35102_11819415413300002568SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQVPRRALHGKGR*
Ga0063454_10033361023300004081SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR*
Ga0063455_10125760223300004153SoilHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR*
Ga0070658_1051519823300005327Corn RhizosphereMHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0070683_10061094813300005329Corn RhizosphereMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0070682_10004275813300005337Corn RhizosphereMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR*
Ga0068868_10008241823300005338Miscanthus RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPASDSRGPKHVL*
Ga0068868_10079966933300005338Miscanthus RhizosphereMHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR*
Ga0070660_10035104213300005339Corn RhizosphereLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR*
Ga0070691_1097061213300005341Corn, Switchgrass And Miscanthus RhizosphereMSVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0070675_10117974013300005354Miscanthus RhizosphereMTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0070663_10126706123300005455Corn RhizosphereHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0070663_10145156823300005455Corn RhizosphereMHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0070662_10162384113300005457Corn RhizosphereMHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR*
Ga0068867_10080202823300005459Miscanthus RhizosphereMHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLNLPLRSTSPSEKRR*
Ga0070664_10037354833300005564Corn RhizosphereMTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR*
Ga0068852_10110295323300005616Corn RhizosphereMAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR*
Ga0068864_10080813823300005618Switchgrass RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR*
Ga0068866_1134215123300005718Miscanthus RhizosphereMHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR*
Ga0068851_1035341833300005834Corn RhizosphereHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0074055_1148846323300006573SoilMTVVTQLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR*
Ga0074053_1195627423300006575SoilMTVVTQLLAAVGTLTEVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR*
Ga0079222_1032756023300006755Agricultural SoilMHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0075430_10013677333300006846Populus RhizosphereVTLHSGRMAVVTQLLAAVGTLTAVVLILLMAAVPFLLDLPQRRAPHSQAPRGKGS*
Ga0075420_10193259023300006853Populus RhizosphereMAVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRGPHRKGR*
Ga0075425_10011386233300006854Populus RhizosphereMHSGRMTLVAHLLAAAGTLAAVVLLLLMAVVPFLLDLPLRPTSKGR*
Ga0075424_10091947213300006904Populus RhizosphereLQMHSGRMTLVAHLLAAAGTLAAVVLLLLMAVVPFLLDLPLRPTSKGR*
Ga0111539_1048224723300009094Populus RhizosphereMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRTPHSQAVRGKGR*
Ga0105245_1059371923300009098Miscanthus RhizosphereMTVVTQLLAAVGTCTAVVLILLMAAVPLLLDLPLRRAPHSQAVRGKGR*
Ga0105245_1148650723300009098Miscanthus RhizosphereMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0105245_1208909223300009098Miscanthus RhizosphereMAVIAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRALQKKGR*
Ga0105243_1057891213300009148Miscanthus RhizosphereMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR*
Ga0111538_1140303723300009156Populus RhizosphereMTVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPHSRGPHRKGR*
Ga0105237_1084021423300009545Corn RhizosphereMTAVTHLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR*
Ga0105237_1249484523300009545Corn RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0105238_1300216213300009551Corn RhizosphereMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0105249_1117854523300009553Switchgrass RhizosphereMTVVTQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0105249_1137299623300009553Switchgrass RhizosphereMAVIAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPHSRTPRPTLGRKGR*
Ga0105249_1156966213300009553Switchgrass RhizosphereMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR*
Ga0105249_1265848423300009553Switchgrass RhizosphereMTVVTQLLAAVGTLTAVVLILLMAVVPLLLDLPLRRAPHSQVPRRALHRKGR*
Ga0105249_1320556813300009553Switchgrass RhizosphereLAAVGALTAVVLILLMSAVPLLLDLPLRPASPSEKRR*
Ga0105239_1179543723300010375Corn RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSQGSHRKGR*
Ga0058701_1072032113300010395AgaveMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSASHSQAPRRKGR
Ga0151490_102296333300011107SoilMTAVTQLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR*
Ga0150985_12079374733300012212Avena Fatua RhizosphereQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSARHSQAPRGKGR*
Ga0150984_10379983233300012469Avena Fatua RhizosphereMTVVTQLLAAVGTLTAGVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR*
Ga0157318_100239823300012482Arabidopsis RhizosphereMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR*
Ga0157345_100857323300012498Arabidopsis RhizosphereMTVVTQLLAAVGTLTAVVLIVLMAAVPLLLDLPLRRAPHSQAVRGKGR*
Ga0157351_103700213300012501Unplanted SoilMTVVTQLLAAVGTVTAVVLIVLMAAVPLLLDLPLRSAPDSRGSHRKGL*
Ga0157293_1022891113300012898SoilMTVVTQLLAAVGTVTAVVLIVLMAAVPLLLDLPLRRAPHSQAVRGKGR*
Ga0157295_1011329423300012906SoilMTVVTQLLAAVGTFTAVALILLMAAVPLLLDLPLRSAPDSRGVQKKGR*
Ga0164300_1054930213300012951SoilMTVVTQLLAAVGTFTAVVMILLMAAVPLLLELPQRPAPDLREPHGKG
Ga0164302_1088796723300012961SoilMTVVRQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPEPRGAHRKGR*
Ga0157371_1144301213300013102Corn RhizosphereMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRSTSPSEKRR*
Ga0157369_1189681923300013105Corn RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRSTSPSEKRR*
Ga0157369_1233162713300013105Corn RhizosphereMTVVTQLFAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0163162_1262671523300013306Switchgrass RhizosphereAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0157377_1023436813300014745Miscanthus RhizosphereMTVVTQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL*
Ga0173480_1113199513300015200SoilMTVVTQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSQAPRRKGR*
Ga0132258_1357780023300015371Arabidopsis RhizosphereMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR*
Ga0184624_1031421533300018073Groundwater SedimentMTAVTQLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR
Ga0190265_1094595323300018422SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGC
Ga0190265_1128712323300018422SoilMTVVTQLLAAVGTLTAAVLILLMAAVPLLLDLPLRSAPHSQAPRRKGC
Ga0190275_1002116953300018432SoilMAVVAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPHSQAPRRKGC
Ga0190275_1055029333300018432SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALHGKGR
Ga0190275_1059152413300018432SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQAPRRALH
Ga0190268_1002842533300018466SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQVPRRTLHGKGR
Ga0190270_1195788613300018469SoilMAVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRGVQKKGR
Ga0190274_1074366713300018476SoilMAVVAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPHSQARPALRRKGR
Ga0190273_1034716813300018920SoilMTVVTQLLFAVGTLTAVALILLMAAVPLLLDLPLRRAPHSQAPRR
Ga0206354_1041733423300020081Corn, Switchgrass And Miscanthus RhizosphereMHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0206353_1043903323300020082Corn, Switchgrass And Miscanthus RhizosphereMHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR
Ga0207656_1033408813300025321Corn RhizospherePLHGRGMHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207642_1007203033300025899Miscanthus RhizosphereMHSGRMALVTHLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR
Ga0207688_1006047623300025901Corn, Switchgrass And Miscanthus RhizosphereMAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207688_1018843313300025901Corn, Switchgrass And Miscanthus RhizosphereMTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL
Ga0207643_1002324373300025908Miscanthus RhizosphereAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR
Ga0207705_1083334013300025909Corn RhizosphereMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207657_1028164523300025919Corn RhizosphereMHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207649_1059051523300025920Corn RhizosphereMAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR
Ga0207687_1046926223300025927Miscanthus RhizosphereMTVVTQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL
Ga0207687_1146833623300025927Miscanthus RhizosphereMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207691_1052872113300025940Miscanthus RhizosphereMTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207712_1147199813300025961Switchgrass RhizosphereAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL
Ga0207640_1009068633300025981Corn RhizosphereMHSGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR
Ga0207640_1196985913300025981Corn RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL
Ga0207658_1129796923300025986Switchgrass RhizosphereRSQPPHGRSMHSGRMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0207677_1007636433300026023Miscanthus RhizosphereMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPASDSRGPKHVL
Ga0207677_1026048023300026023Miscanthus RhizosphereMSVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSTSPSEKRR
Ga0207678_1141946213300026067Corn RhizosphereGLRAHSGRMTVVSQLLAAVGTFTAVVLILLMAAVPLLLDLPLRPASDSRGPKHVL
Ga0207648_1104156623300026089Miscanthus RhizosphereMTVVTQLLAAVGTLTAVVLILLMAAVPLLLNLPLRSTSPSEKRR
Ga0207698_1053333123300026142Corn RhizosphereMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR
Ga0207698_1064926313300026142Corn RhizosphereAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL
Ga0209574_1023405423300027809AgaveMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRAGSHSRVPRGKGR
Ga0268266_1137941123300028379Switchgrass RhizosphereMTVVTQLLAAVGTLTAVVLILLMAVVPLLLDLPLRRAPHSQVPRRALHGKGR
Ga0247818_1069203623300028589SoilMAVIAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRALQKKGR
Ga0247818_1104850613300028589SoilGRMTVVTQLFAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR
Ga0247822_1013147123300028592SoilMAVIAQLLAAVGTLTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR
Ga0247820_1128419423300028597SoilLHSGRMAVVTQLLAAVGALTAVVLILLMAAVPLLLDLPQRRAPHSQAPRGKGS
Ga0307297_1003076333300028754SoilMTVVTQVLAAVGALTAVVLILLMAAVPLLLDLPLRRAPHSQAVRGKGR
Ga0247825_1038614933300028812SoilRAHSGRMAVVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPDSRGVQKKGR
Ga0247825_1043508013300028812SoilRMTVVSQLLAAVGTCTAVVLILLMAAVPLLLDLPLRPAPDSRGPKHVL
Ga0247825_1052253213300028812SoilHGRGMHSGHMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0247825_1144547423300028812SoilGRMAVVTQLLAAVGALTAGVLILLMAAVPLLLDLPQRRAPHSQAPRGKGS
Ga0247827_1130034513300028889SoilMTVVTQLLAAVGALTAVVLILLMAAVPLLLDLPLRPASPSE
Ga0247826_1086818113300030336SoilMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0247826_1103358123300030336SoilMTAVTHLLAAAGTLTAVVLIVLMALVPLLLDLPLRRAPHSQAVRGKGR
Ga0310887_1050705013300031547SoilGHGLRAHSGRMAVIAQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR
Ga0310904_1044744023300031854SoilMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR
Ga0308176_1055927723300031996SoilMTVVTQLLAAVGTFTAVVLILLMAAVPVLLDLPLRPAPHSRRPHGKGR
Ga0310906_1111713213300032013SoilERAHSGPMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRTPHSQAVRGKGR
Ga0310890_1014963633300032075SoilMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRTPHSQAVRGKGR
Ga0310890_1166381623300032075SoilMTVVTQLLAAVGTFTAVVLILLMAAVPLLLDLPLRSAPDSRGVQKKGR
Ga0326721_1012435513300032080SoilVAQLLAAVGTLTAVFLILLMAAVPLLLDLPLRSAPHSRGPHRKGR
Ga0310896_1094977823300032211SoilMTVVTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQAVRGKGR
Ga0247830_1079952613300033551SoilGHMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRPASPSEKRR
Ga0334936_018573_1340_14803300034007BiocrustVSELLAAVGTLTAVALILLMAVVPILLDLPLDHAARSRPGIRRWTD
Ga0334927_058814_152_3103300034024Hypolithic BiocrustMTVVTQLLAAVGTLTAVVLILLMAAVPLLLDLPLRRAPHSQVPRRALHGKGR
Ga0314788_143052_441_5753300034666SoilTQLLAAVGTLTAVVLIVLMAVVPLLLDLPLRRAPHSQTVRGKGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.