Basic Information | |
---|---|
Family ID | F073885 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 43 residues |
Representative Sequence | MSLKSLVLCSDEKIVRVLRRVLGDLDIAVELCADSDTALRKL |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.75 % |
% of genes near scaffold ends (potentially truncated) | 99.17 % |
% of genes from short scaffolds (< 2000 bps) | 92.50 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.833 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (10.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.14% β-sheet: 11.43% Coil/Unstructured: 61.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF13548 | DUF4126 | 12.50 |
PF01541 | GIY-YIG | 0.83 |
PF05532 | CsbD | 0.83 |
PF06224 | HTH_42 | 0.83 |
PF07676 | PD40 | 0.83 |
PF13581 | HATPase_c_2 | 0.83 |
PF12838 | Fer4_7 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.83 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.83 % |
Unclassified | root | N/A | 29.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918007|ConsensusfromContig154996 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
2140918007|ConsensusfromContig172410 | Not Available | 861 | Open in IMG/M |
3300000567|JGI12270J11330_10017446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4534 | Open in IMG/M |
3300000789|JGI1027J11758_12788910 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300001471|JGI12712J15308_10121170 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300001471|JGI12712J15308_10168316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300001593|JGI12635J15846_10356103 | Not Available | 896 | Open in IMG/M |
3300004080|Ga0062385_10516566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300004082|Ga0062384_100172144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1250 | Open in IMG/M |
3300004091|Ga0062387_101479069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300004092|Ga0062389_101380226 | Not Available | 889 | Open in IMG/M |
3300004092|Ga0062389_101478456 | Not Available | 863 | Open in IMG/M |
3300004635|Ga0062388_100264195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1410 | Open in IMG/M |
3300005435|Ga0070714_100732847 | Not Available | 955 | Open in IMG/M |
3300005437|Ga0070710_10195837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1273 | Open in IMG/M |
3300005445|Ga0070708_101675111 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005455|Ga0070663_100742319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300005575|Ga0066702_10043121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2389 | Open in IMG/M |
3300005591|Ga0070761_10862984 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005602|Ga0070762_10572039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300005610|Ga0070763_10241995 | Not Available | 975 | Open in IMG/M |
3300006028|Ga0070717_10289170 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300006028|Ga0070717_10903749 | Not Available | 804 | Open in IMG/M |
3300006059|Ga0075017_100166601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1578 | Open in IMG/M |
3300006059|Ga0075017_101405819 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006086|Ga0075019_10826799 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300006174|Ga0075014_100280086 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300006174|Ga0075014_100379535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
3300006797|Ga0066659_11810593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300006804|Ga0079221_11591787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300009038|Ga0099829_10547712 | Not Available | 961 | Open in IMG/M |
3300009090|Ga0099827_10311875 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300009545|Ga0105237_11598765 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300009616|Ga0116111_1168627 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010341|Ga0074045_10282576 | Not Available | 1091 | Open in IMG/M |
3300010361|Ga0126378_12379699 | Not Available | 605 | Open in IMG/M |
3300010366|Ga0126379_11454170 | Not Available | 791 | Open in IMG/M |
3300010376|Ga0126381_103755727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300010379|Ga0136449_100117557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5364 | Open in IMG/M |
3300011269|Ga0137392_11534394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300012356|Ga0137371_11184894 | Not Available | 571 | Open in IMG/M |
3300012989|Ga0164305_10793082 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300013296|Ga0157374_10330813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1511 | Open in IMG/M |
3300013296|Ga0157374_11468148 | Not Available | 705 | Open in IMG/M |
3300014489|Ga0182018_10259516 | Not Available | 954 | Open in IMG/M |
3300017942|Ga0187808_10571668 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300017946|Ga0187879_10529079 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300017970|Ga0187783_10351934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1072 | Open in IMG/M |
3300017970|Ga0187783_10804158 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300017970|Ga0187783_10989185 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300017970|Ga0187783_11111068 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300017972|Ga0187781_11063310 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300017972|Ga0187781_11261218 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300017973|Ga0187780_10336699 | Not Available | 1064 | Open in IMG/M |
3300017975|Ga0187782_10912337 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300017975|Ga0187782_11108103 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300017975|Ga0187782_11168419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300017999|Ga0187767_10075740 | Not Available | 889 | Open in IMG/M |
3300018035|Ga0187875_10440114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300018047|Ga0187859_10251566 | Not Available | 949 | Open in IMG/M |
3300018057|Ga0187858_10443908 | Not Available | 800 | Open in IMG/M |
3300018057|Ga0187858_10626492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300018090|Ga0187770_11718847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300019887|Ga0193729_1238831 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300020004|Ga0193755_1164728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300020580|Ga0210403_10572227 | Not Available | 914 | Open in IMG/M |
3300021181|Ga0210388_10464244 | Not Available | 1112 | Open in IMG/M |
3300021401|Ga0210393_11575579 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300021402|Ga0210385_10941858 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300021478|Ga0210402_10528204 | Not Available | 1095 | Open in IMG/M |
3300021479|Ga0210410_10147134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2099 | Open in IMG/M |
3300022521|Ga0224541_1011090 | Not Available | 972 | Open in IMG/M |
3300024227|Ga0228598_1083755 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300025414|Ga0208935_1013575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1101 | Open in IMG/M |
3300025612|Ga0208691_1093679 | Not Available | 677 | Open in IMG/M |
3300025906|Ga0207699_11415932 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300025910|Ga0207684_10470660 | Not Available | 1078 | Open in IMG/M |
3300025915|Ga0207693_10129940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1980 | Open in IMG/M |
3300025916|Ga0207663_10297073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1205 | Open in IMG/M |
3300025928|Ga0207700_11481211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300025929|Ga0207664_11345224 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300026035|Ga0207703_10050237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3374 | Open in IMG/M |
3300026078|Ga0207702_10047713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3610 | Open in IMG/M |
3300026325|Ga0209152_10182847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300026489|Ga0257160_1082305 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300026527|Ga0209059_1125464 | Not Available | 974 | Open in IMG/M |
3300026550|Ga0209474_10721371 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300027039|Ga0207855_1044000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300027625|Ga0208044_1107031 | Not Available | 809 | Open in IMG/M |
3300027652|Ga0209007_1018192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1821 | Open in IMG/M |
3300027652|Ga0209007_1186461 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027698|Ga0209446_1090205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300027725|Ga0209178_1409492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300027783|Ga0209448_10070284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1177 | Open in IMG/M |
3300027842|Ga0209580_10256408 | Not Available | 870 | Open in IMG/M |
3300027842|Ga0209580_10485331 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300027875|Ga0209283_10930677 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300027879|Ga0209169_10043733 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
3300027884|Ga0209275_10762765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300027889|Ga0209380_10877198 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300027895|Ga0209624_10117694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1743 | Open in IMG/M |
3300027911|Ga0209698_11319002 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300028020|Ga0265351_1004327 | Not Available | 1097 | Open in IMG/M |
3300028800|Ga0265338_11167277 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300028906|Ga0308309_10814673 | Not Available | 811 | Open in IMG/M |
3300029907|Ga0311329_10277067 | Not Available | 1232 | Open in IMG/M |
3300030659|Ga0316363_10273166 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300031090|Ga0265760_10163982 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300031122|Ga0170822_10178443 | Not Available | 923 | Open in IMG/M |
3300031231|Ga0170824_127994262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1959 | Open in IMG/M |
3300031233|Ga0302307_10224217 | Not Available | 967 | Open in IMG/M |
3300031754|Ga0307475_11248880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300031996|Ga0308176_12125302 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300031996|Ga0308176_12241770 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300032180|Ga0307471_102455253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300032895|Ga0335074_10761645 | Not Available | 914 | Open in IMG/M |
3300032898|Ga0335072_10040931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6334 | Open in IMG/M |
3300032955|Ga0335076_10706836 | Not Available | 889 | Open in IMG/M |
3300033289|Ga0310914_11836051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 10.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.50% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.33% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.67% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.83% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A_all_C_03517590 | 2140918007 | Soil | MSLKSLVLCSDEKIVRVLRRVLGDLDIDVELCADSDSVLRKLTRQRCEAMIVDFA |
A_all_C_01226000 | 2140918007 | Soil | MRLQALLLTPDEKIERVLRRVLGDLEISVEYCADTDSA |
JGI12270J11330_100174467 | 3300000567 | Peatlands Soil | MNLRSLVLCSDEKIVRVLRRVLGDLDIAVELCSDADSAL |
JGI1027J11758_127889101 | 3300000789 | Soil | MGLKSLLLCSDEKIVRVLRRVLGDLEIEVDLCPNSDAALRKLTRHRFEGIIADLADDGAIEVL |
JGI12712J15308_101211701 | 3300001471 | Forest Soil | MSLKALVLCSDEKVVRVLRRTLGDLDIAMEMCADSDAALRRLTRQRYEGII |
JGI12712J15308_101683161 | 3300001471 | Forest Soil | MGLKSLLLCSDEKIVRVLRRVLGDLDIAVELCLDADSALRKLTRQ |
JGI12635J15846_103561031 | 3300001593 | Forest Soil | MSLKALLLCSDAKIVRVLRRVLGDLEIAVELCADGDSALRKLTRERF |
Ga0062385_105165661 | 3300004080 | Bog Forest Soil | MSLKSLVLCADEKIVRVLRRVLGDLDIAVELCGDSDAALRKLTRQR |
Ga0062384_1001721441 | 3300004082 | Bog Forest Soil | MILKSLVLCSDEKIVRVLRRTLGDLEIGVELCADADSALRKL |
Ga0062387_1014790691 | 3300004091 | Bog Forest Soil | MSLKSLVLCSDEKIVRVLRRVLGDLDIAVELCADSDTALRKL |
Ga0062389_1013802261 | 3300004092 | Bog Forest Soil | MTLKSLLLCADEKIVRVLRRTLGDLDISVEHCTSAEAALRHLTRD |
Ga0062389_1014784562 | 3300004092 | Bog Forest Soil | MSLKSLVLCADEKIVRVLRRVLGDLDIGVELCVDSDSALR |
Ga0062388_1002641951 | 3300004635 | Bog Forest Soil | MILKSLVLCSDEKIVRVLRRTLGDLEIGVELCADADSALRKLTRERFEA |
Ga0070714_1007328472 | 3300005435 | Agricultural Soil | MGLKSLLLCSDEKIVRVLRRVMGDLEIEVELCPNSETALRKLTRQR |
Ga0070710_101958373 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MALKSLLLCSDEKIVRVVRRVLGDLEIEVELCLTADSALRKLTRQR |
Ga0070708_1016751111 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKALLLCSDEKIVRVLRRTLGDLEIGVELCSDGDAALRKLTR |
Ga0070663_1007423193 | 3300005455 | Corn Rhizosphere | MKSAMNLQALVLCSDEKIVRVLRRVLNDLEIAVELCSDAELAIQKLSRRRFE |
Ga0066702_100431211 | 3300005575 | Soil | MGLKALLLCSDEKIVRVLRRVLGDLDIELQVCADADS |
Ga0070761_108629842 | 3300005591 | Soil | MKLKSLLLCSDEKIVRVLRRTLGDLDIGVEHSASSEIALRHL |
Ga0070762_105720391 | 3300005602 | Soil | MSLKSLVLCSDEKIIRVLRRVLGDLDISVDLCVNSDAALRKLTRER |
Ga0070763_102419951 | 3300005610 | Soil | MGLKSLLLCSDEKIVRVLRRVLGDLDIEVDLCLNSDTAL |
Ga0070717_102891703 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKSLLLCSDEKIVRVLRRVLGDLDIEVDLCLNSDTALRKLTRERFEGIIADMSDD |
Ga0070717_109037491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLKSLLLCSDEKIVRVLRRTLGDLDIGVELCSTA |
Ga0075017_1001666013 | 3300006059 | Watersheds | MSLKSLLLCSDEKIVRVLRRVLGDLEIDVELCPTADSA |
Ga0075017_1014058191 | 3300006059 | Watersheds | MNLKALLLCSDEKIVRVLRRTLGDLDVSVEHCTGSEAALRYLTRERFE |
Ga0075019_108267991 | 3300006086 | Watersheds | VRLPEDGLLMSLKSLLLCSDEKIVRVLRRVLGDLDIAVDLCSDADAALRK |
Ga0075014_1002800861 | 3300006174 | Watersheds | MSLKSLVLCSDEKIVRVLRRVLGDLEIAVELCSDSDAALRKLT |
Ga0075014_1003795351 | 3300006174 | Watersheds | MSLKSLVLSSDEKIVRVLRRVLNDLEIAVEHCNHPD |
Ga0066659_118105931 | 3300006797 | Soil | MNLQALLLCSDDKIVRVLRRVLNDLEIAVEHCADSEIA |
Ga0079221_115917872 | 3300006804 | Agricultural Soil | MKSAMNLQALVLCSDEKIVRVLRRVLNDLEIAVELCSDAELA |
Ga0099829_105477122 | 3300009038 | Vadose Zone Soil | VDLKSLLLCSDEKIVRVLRRTLGDLEIGVEHCTSSEVALRHLTRERFE |
Ga0099827_103118753 | 3300009090 | Vadose Zone Soil | VDLKSLLLCSDEKIVRVLRRTLGDLEIGVEHCTSSEVALR |
Ga0105237_115987651 | 3300009545 | Corn Rhizosphere | MSLKSLVYCSDEKIVRVLRRVLCDLEITVEHCADSDSAIHKLTRQRF |
Ga0116111_11686271 | 3300009616 | Peatland | MNLKALLLCSDDKIVRVLRRTLGDLDIEVEHCTNSEAAL |
Ga0074045_102825761 | 3300010341 | Bog Forest Soil | MSLKALVLCSDDKIVRVLRRTLGDLDIVMEMCADADTA |
Ga0126378_123796992 | 3300010361 | Tropical Forest Soil | MSLKSLVLCSDENIVRVLRRVLCELEIAMEHCSEPE |
Ga0126379_114541701 | 3300010366 | Tropical Forest Soil | MTPGRLLSMALKSLLLCSDEKIVRVVRRVLGDLEIEVELCLNADSAL |
Ga0126381_1037557272 | 3300010376 | Tropical Forest Soil | MGLKCLLLCSDEKIVRVLRRVLGDLEIEVDLCANSDAALRKLT |
Ga0136449_1001175571 | 3300010379 | Peatlands Soil | MNLKALLLCSDDKIVRVLRRTLGDLDIEVEHCTNS |
Ga0137392_115343942 | 3300011269 | Vadose Zone Soil | MSLKSLLLCSDEKIVRVLRRTLGDLEIDVELCASSE |
Ga0137388_111911091 | 3300012189 | Vadose Zone Soil | MSLQSLVLCSDEKIVRVLRPVLDALAIRLEHCTAADSAIPQLTRQ |
Ga0137371_111848941 | 3300012356 | Vadose Zone Soil | MSLKALVLCSDEKIVRVLRRTLGDLEIGVELCTNADSALRKLTRD |
Ga0164305_107930822 | 3300012989 | Soil | MGLKSLLLCSDEKIVRVLRRVLGDLDIELHVCADADSALYRLTRRRFEGIIVDCA |
Ga0157374_103308131 | 3300013296 | Miscanthus Rhizosphere | MRLQALLLTPDEKIERVLRRVLGDLEISVEDCADTDSAVNELTRDRVEDVI |
Ga0157374_114681482 | 3300013296 | Miscanthus Rhizosphere | MGLKALLLCSDEKIVRVLRRVLGDLDIELQVCADADSALYR |
Ga0182018_102595161 | 3300014489 | Palsa | MDLKSLLLCSDEKIVRVLRRTLSELDISVEHCPSSEVALSHLTRGR |
Ga0187808_105716681 | 3300017942 | Freshwater Sediment | MDLKALVLCSDEKIVRVLRRTLGDLEIGVEVCTDNES |
Ga0187879_105290791 | 3300017946 | Peatland | MTLKSLLLCSDDKIVRVLRRTLGDLDIGVEHCANAEAALRHLTRN |
Ga0187783_103519341 | 3300017970 | Tropical Peatland | MSLNALVLCSDDKIVRVLRRTLGDLEIGVELCTDADAALRQLTRRRF |
Ga0187783_108041581 | 3300017970 | Tropical Peatland | MSLKSLVLCSDEKIVRVLRRVLGDLEIAVELCTDSDSAL |
Ga0187783_109891851 | 3300017970 | Tropical Peatland | MELKALVLCSDDKIVRVLRRTLGDLEIGVELCTDPEGALRKL |
Ga0187783_111110682 | 3300017970 | Tropical Peatland | MSLKALLLCSDEKIVRVLRRTLSDLDIAVELCGEADAALRKLTRQRYE |
Ga0187781_110633101 | 3300017972 | Tropical Peatland | MSLKALVLCSDEKIVRVLRRTLGDLDIALEVCENSGTALRKLSRQ |
Ga0187781_112612181 | 3300017972 | Tropical Peatland | MAQVMSLNALLLTSDEKIARLLRRTLGDLDIGVEICADSDSALRK |
Ga0187780_103366992 | 3300017973 | Tropical Peatland | MEMAPAMSLNALVLCSDDKIIRVLRRTLGDLEIGVELCSDADGALRKLTRRRYEA |
Ga0187782_109123371 | 3300017975 | Tropical Peatland | MSLNALVLCSDEKIVRVLRRTLGDLEISVEICADPDSALRKLTRRRFEAIVVDCAGEGSS |
Ga0187782_111081031 | 3300017975 | Tropical Peatland | MSLKALVLCSDEKIVRVLRRTLGDLDIAIDMCANSDAAL |
Ga0187782_111684191 | 3300017975 | Tropical Peatland | MTLKSLVLCSDEKIVRVLRRVLGDLEIDIELCSTTDSALRRLTRQ |
Ga0187767_100757403 | 3300017999 | Tropical Peatland | MSLQSLVLCSDEKIVRVLRRVLNELEIAAEYCAEAEAAVHKLT |
Ga0187875_104401141 | 3300018035 | Peatland | MSLKALLLCADEKIVRVLRRVLGDLDIAVELCADS |
Ga0187859_102515662 | 3300018047 | Peatland | MSLKSLVLCADEKIVRVLRRVLGDLDIAVELCVDSDGALRRLTRQRF |
Ga0187858_104439081 | 3300018057 | Peatland | MRLKSLLLCSDDKIVRVLRRTLGDLNIEVEHCTNAEVALSHLTRDRF |
Ga0187858_106264921 | 3300018057 | Peatland | MSLKSLVLCADEKIVRVLRRVLGDLDIAVELCVDSDGALRRLTRQ |
Ga0187770_117188471 | 3300018090 | Tropical Peatland | MTLKALVLCSDDKIVRVLRRVLGDLEIAIELCPNSDAALRKLTRERFEAIVVDCVEDGSSEV |
Ga0193729_12388311 | 3300019887 | Soil | VDLKSLLLCSDEKIVRVLRRTLGDLEIGVEHCTNSEVALRHLTRER |
Ga0193755_11647282 | 3300020004 | Soil | MGLMSLVLCDDEKIVRVLRRVLNDLEIGIEHCTDPDGAVHKLTRQRF |
Ga0210403_105722271 | 3300020580 | Soil | MSLKSLVLCADEKIVRVLRRVLGDLDIGVELCADAD |
Ga0210388_104642441 | 3300021181 | Soil | MSLKSLVLCADEKIVRVLRRVLGDLEIGVELCTDSD |
Ga0210393_115755791 | 3300021401 | Soil | MSLKSMVLCSDEKIVRVLRRTLGDLDIAVDLCSDSDEALRKL |
Ga0210385_109418581 | 3300021402 | Soil | MSLKSLVLCADEKIVRVLRRVMGDLDIAVELCVDADS |
Ga0210402_105282041 | 3300021478 | Soil | MSLKSLVLCADEKIVRVLRRVLGDLDIAVELCGDSDAALRKLTRER |
Ga0210410_101471344 | 3300021479 | Soil | MNLKCLLLCSDDKIVRVLRRTLGDLDISVEHCTSSEIA |
Ga0224541_10110901 | 3300022521 | Soil | MKLKSLLLCSDDKIVRVLRRTLGDLDISVEPCASAEVALRHLTRERFEA |
Ga0228598_10837551 | 3300024227 | Rhizosphere | VRAMTLKSLLLCSDDKIVRVLRRTLGDLEIGVELCADADS |
Ga0208935_10135753 | 3300025414 | Peatland | MTLKSLLLCSDDKIVRVLRRTLGDLDIGVEHCTSSETALRHLTRERFEA |
Ga0208691_10936791 | 3300025612 | Peatland | MKLRALLLCSDEKIVRVVRRTLGDLDIAIEHCPAA |
Ga0207699_114159321 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKALLLCSDDKIVRVLRRVLGDLDIELQVCADADSALYR |
Ga0207684_104706603 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLKSLLLCSDEKIVRVLRRTLSDLEIEVELCADSESALRKLTRERFE |
Ga0207693_101299401 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKSLLLCSDEKIVRVLRRVLGDLDIEVDLCLNSDTALRKLTR |
Ga0207663_102970731 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKSLLLCSDEKIVRVLRRVMGDLEIEVELCPNSETALRKLT |
Ga0207700_114812111 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLKSLLLCSDEKIVRVLRRVLGDLDIEVDLCLNSDTALRKLTRERFEGIIADMSD |
Ga0207664_113452241 | 3300025929 | Agricultural Soil | MGLKALLLCSDDKIVRVLRRVLGDLDIELQVCADADSAL |
Ga0207703_100502371 | 3300026035 | Switchgrass Rhizosphere | MRLQALLLTPDEKIERVLRRVLGDLEISVEYCADTDSALNKL |
Ga0207702_100477135 | 3300026078 | Corn Rhizosphere | MGLKSLLLCSDEKIVRVLRRVLGDLDIEIELCADADSALY |
Ga0209152_101828473 | 3300026325 | Soil | MKSAMNLQALVLCSDEKIVRVLRRVLNDLEIAVEL |
Ga0257160_10823051 | 3300026489 | Soil | MNLKSLLLCADEKIVRVLRRTLGDLEIAVELCASAELA |
Ga0209059_11254642 | 3300026527 | Soil | MGLKALLLCSDEKIVRVLRRVLGDLDIELQVCADADSALYRL |
Ga0209474_107213711 | 3300026550 | Soil | MSLQALLFCSDDKIVRVLRRVLGDLEVDVEHCTELDSA |
Ga0207855_10440001 | 3300027039 | Tropical Forest Soil | MGLKSLLLCSDEKIVRVLRRVLGDLDIEVDLCPNADAALRKLTRERFE |
Ga0208044_11070312 | 3300027625 | Peatlands Soil | MTLKSLLLCSDEKIVRVLRRTLGDLDIGVELCANSDA |
Ga0209007_10181924 | 3300027652 | Forest Soil | MSLKSLVLCSDDKVVRVLRRVLGDLDIEVDLCATSDAALRKL |
Ga0209007_11864611 | 3300027652 | Forest Soil | MKLSSLLLCSDDKIVRVLRRTLADLDINVEYCVDVDAALRHLTRSRFE |
Ga0209446_10902052 | 3300027698 | Bog Forest Soil | MSLKALVLCSDDKIVRVLRRTLGDLDIVMEMCADA |
Ga0209178_14094922 | 3300027725 | Agricultural Soil | MKSAMNLQALVLCSDEKIVRVLRRVLNDLEIAVELCSD |
Ga0209448_100702841 | 3300027783 | Bog Forest Soil | MSLKSLLLCSDEKIVRVLRRVLGDLDISVDLCSDADAALRKLTRQRF |
Ga0209580_102564081 | 3300027842 | Surface Soil | MGLKSLLLCADEKIVRVLRRVLGDLEIDVELCASSDAALRKLTRQ |
Ga0209580_104853311 | 3300027842 | Surface Soil | MSLKALLLCSDAKIVRVLRRVLGDLDIAVELCADADSALR |
Ga0209283_109306771 | 3300027875 | Vadose Zone Soil | MNLKSLLLCADEKIVRVLRRTLGDLDIGVELCASPEMA |
Ga0209169_100437334 | 3300027879 | Soil | MTLKSLLLCSDEKIVRVLRRTLGDLEIGVELCADADTALR |
Ga0209275_107627651 | 3300027884 | Soil | MGLKSLLLCSDEKIVRVLRRVLGDLEIEVELCPNSE |
Ga0209380_108771981 | 3300027889 | Soil | MSLKSLVLCADEKIVRVLRRVLGDLEIGVELCSDADSALRKLTRERYEAI |
Ga0209624_101176941 | 3300027895 | Forest Soil | MEMGFTMSLKALLLCSDAKIVRVLRRVLGDLEIDVELCADGDSALRK |
Ga0209698_113190021 | 3300027911 | Watersheds | MNLHALVLCSDEKIVRVLRRALVDLDIGIEVCGDPDSALRKLTRS |
Ga0265351_10043272 | 3300028020 | Soil | VDLKCLLLCSDDKIVRVLRRTLGDLEISVEHCTSSEVALRHLTR |
Ga0265338_111672771 | 3300028800 | Rhizosphere | MSLKALVLCSDEKIVRVLRRVLGDLDIAVDLCSDSDAALRKLTRERFEAIVAD |
Ga0308309_108146732 | 3300028906 | Soil | MNLKSLLLCSDDKIVRVLRRTLGDLDIGVELCASSEIALR |
Ga0311329_102770672 | 3300029907 | Bog | MTLKSLLLCADEKIVRVLRRTLGDLDIGVELCASSDVALRKLT |
Ga0316363_102731661 | 3300030659 | Peatlands Soil | MTLKSLLLCSDEKIVRVLRRTLGDLDIGVELCANSDAALRKLT |
Ga0265760_101639821 | 3300031090 | Soil | MTLKSLLLCSDDKIVRVLRRTLGDLEIGVELCADADSALRK |
Ga0170822_101784432 | 3300031122 | Forest Soil | MGLKSLLLCSDEKIVRVLRRVLGDLEIEVDLCLNS |
Ga0170824_1279942624 | 3300031231 | Forest Soil | MSLKSLVLCSDEKIVRVLRRVLGDLDIAVELCADSD |
Ga0302307_102242171 | 3300031233 | Palsa | MTLKSLVLCSDDKIVRVLRRTLGDLEIGVELCADADSALRK |
Ga0307475_112488801 | 3300031754 | Hardwood Forest Soil | MSLKSLVLCSDQKIVRVLRRVLGDLDIAVELCADSD |
Ga0308176_121253021 | 3300031996 | Soil | MGLKSLLLCSDEKIVRVLRRVLGDLDIELQVCADADSALYRLTRR |
Ga0308176_122417702 | 3300031996 | Soil | MGLKALLLCSDDKIVRVLRRVLGDLDIELQVCADADSA |
Ga0307471_1024552532 | 3300032180 | Hardwood Forest Soil | MRNGLPMGLKSLLLCSDEKIVRVLRRVLGDLDIEVDLCLNSDTALRKL |
Ga0335074_107616451 | 3300032895 | Soil | MSLKSLLLCSDEKIVRVLRRVLGDLEIGIELCPNSDAVLRKLTRQ |
Ga0335072_100409318 | 3300032898 | Soil | MSLNSLVLCSDDKIVRVLRRSLGDLDIAVELCSDSA |
Ga0335076_107068362 | 3300032955 | Soil | MALKSLILCSDDKIVRVLRRVLGDLDIEIDLCPNSDAALRRLT |
Ga0310914_118360511 | 3300033289 | Soil | MALKSLLLCSDEKIVRVLRRVLGDLDIEVELCPTA |
⦗Top⦘ |