NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F073909

Metagenome Family F073909

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073909
Family Type Metagenome
Number of Sequences 120
Average Sequence Length 37 residues
Representative Sequence MGTTLHTFSERVQLTLAIALLVACAANVALVWAFL
Number of Associated Samples 97
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 49.17 %
% of genes near scaffold ends (potentially truncated) 11.67 %
% of genes from short scaffolds (< 2000 bps) 75.83 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(24.167 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.79%    β-sheet: 0.00%    Coil/Unstructured: 49.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF13505OMP_b-brl 16.67
PF00561Abhydrolase_1 5.83
PF12697Abhydrolase_6 1.67
PF12146Hydrolase_4 1.67
PF07883Cupin_2 0.83
PF01075Glyco_transf_9 0.83
PF13424TPR_12 0.83
PF13450NAD_binding_8 0.83
PF01636APH 0.83
PF00144Beta-lactamase 0.83
PF00528BPD_transp_1 0.83
PF01627Hpt 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 0.83
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.83
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.83
COG2367Beta-lactamase class ADefense mechanisms [V] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.17 %
UnclassifiedrootN/A5.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y02GJ029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii591Open in IMG/M
3300001867|JGI12627J18819_10001990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-27329Open in IMG/M
3300005332|Ga0066388_101410527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1211Open in IMG/M
3300005332|Ga0066388_104166796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium737Open in IMG/M
3300005434|Ga0070709_10025520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3493Open in IMG/M
3300005529|Ga0070741_10000314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2184158Open in IMG/M
3300005531|Ga0070738_10001234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium55024Open in IMG/M
3300005532|Ga0070739_10420135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium617Open in IMG/M
3300005533|Ga0070734_10015881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5169Open in IMG/M
3300005534|Ga0070735_10176356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1316Open in IMG/M
3300005598|Ga0066706_10073356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2403Open in IMG/M
3300005764|Ga0066903_100713932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR651771Open in IMG/M
3300005944|Ga0066788_10061261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium897Open in IMG/M
3300005995|Ga0066790_10047045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00691869Open in IMG/M
3300006050|Ga0075028_100017867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3079Open in IMG/M
3300006173|Ga0070716_101057482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium645Open in IMG/M
3300006804|Ga0079221_10142807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1241Open in IMG/M
3300006852|Ga0075433_11525122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium577Open in IMG/M
3300007265|Ga0099794_10569729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium598Open in IMG/M
3300009038|Ga0099829_10975739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium703Open in IMG/M
3300009090|Ga0099827_10033749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3720Open in IMG/M
3300009137|Ga0066709_100464650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1773Open in IMG/M
3300009792|Ga0126374_10034320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR652417Open in IMG/M
3300009792|Ga0126374_10719961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.753Open in IMG/M
3300009826|Ga0123355_11164332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium792Open in IMG/M
3300010043|Ga0126380_11279901All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300010043|Ga0126380_11534788Not Available591Open in IMG/M
3300010048|Ga0126373_10764233Not Available1027Open in IMG/M
3300010049|Ga0123356_10267182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1798Open in IMG/M
3300010049|Ga0123356_13391111Not Available553Open in IMG/M
3300010049|Ga0123356_13477771Not Available546Open in IMG/M
3300010159|Ga0099796_10528527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium529Open in IMG/M
3300010361|Ga0126378_13404291Not Available505Open in IMG/M
3300010362|Ga0126377_10760554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1025Open in IMG/M
3300010376|Ga0126381_101665459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium922Open in IMG/M
3300010376|Ga0126381_102895175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria683Open in IMG/M
3300010376|Ga0126381_103206196Not Available647Open in IMG/M
3300010376|Ga0126381_103730239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae596Open in IMG/M
3300010376|Ga0126381_104930435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65512Open in IMG/M
3300011269|Ga0137392_10432885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1092Open in IMG/M
3300011418|Ga0153954_1006495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3858Open in IMG/M
3300012096|Ga0137389_10251213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1486Open in IMG/M
3300012199|Ga0137383_10005810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7972Open in IMG/M
3300012202|Ga0137363_10259375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1415Open in IMG/M
3300012203|Ga0137399_10192987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1650Open in IMG/M
3300012357|Ga0137384_10597670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium901Open in IMG/M
3300012359|Ga0137385_10738480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium820Open in IMG/M
3300012685|Ga0137397_10205256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1466Open in IMG/M
3300012929|Ga0137404_10423156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1178Open in IMG/M
3300012930|Ga0137407_10182998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1871Open in IMG/M
3300012930|Ga0137407_11067403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium765Open in IMG/M
3300012930|Ga0137407_11510528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium639Open in IMG/M
3300012944|Ga0137410_10021069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4488Open in IMG/M
3300012971|Ga0126369_10608895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1163Open in IMG/M
3300016341|Ga0182035_10537969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1002Open in IMG/M
3300016341|Ga0182035_10742419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium858Open in IMG/M
3300017947|Ga0187785_10161236All Organisms → cellular organisms → Bacteria → Proteobacteria950Open in IMG/M
3300017973|Ga0187780_11463620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300018062|Ga0187784_10406544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1101Open in IMG/M
3300018085|Ga0187772_10014630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4371Open in IMG/M
3300019789|Ga0137408_1183142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium812Open in IMG/M
3300020170|Ga0179594_10000840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6743Open in IMG/M
3300020170|Ga0179594_10113925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium981Open in IMG/M
3300020199|Ga0179592_10033153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2331Open in IMG/M
3300020579|Ga0210407_10003148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium13593Open in IMG/M
3300020580|Ga0210403_10605591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense884Open in IMG/M
3300021086|Ga0179596_10049420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1736Open in IMG/M
3300021086|Ga0179596_10231237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium908Open in IMG/M
3300021086|Ga0179596_10358439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium733Open in IMG/M
3300021168|Ga0210406_11337264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300021361|Ga0213872_10367114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium588Open in IMG/M
3300021444|Ga0213878_10242196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium765Open in IMG/M
3300021475|Ga0210392_10249952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1256Open in IMG/M
3300021560|Ga0126371_10002917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium14883Open in IMG/M
3300021560|Ga0126371_10183597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2178Open in IMG/M
3300025910|Ga0207684_10108060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2381Open in IMG/M
3300026215|Ga0209849_1028965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae951Open in IMG/M
3300026548|Ga0209161_10190395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1146Open in IMG/M
3300027502|Ga0209622_1068016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65650Open in IMG/M
3300027548|Ga0209523_1031357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1066Open in IMG/M
3300027725|Ga0209178_1420822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium510Open in IMG/M
3300027812|Ga0209656_10496403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium534Open in IMG/M
3300027826|Ga0209060_10016603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3986Open in IMG/M
3300027826|Ga0209060_10028438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-22836Open in IMG/M
3300027826|Ga0209060_10136581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1140Open in IMG/M
3300027869|Ga0209579_10195141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-21084Open in IMG/M
3300027894|Ga0209068_10093340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1580Open in IMG/M
3300027965|Ga0209062_1007677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-29207Open in IMG/M
3300031247|Ga0265340_10053218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1955Open in IMG/M
3300031543|Ga0318516_10378640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae816Open in IMG/M
3300031544|Ga0318534_10312897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium905Open in IMG/M
3300031715|Ga0307476_10004341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-28540Open in IMG/M
3300031719|Ga0306917_10623605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium848Open in IMG/M
3300031753|Ga0307477_10394529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium948Open in IMG/M
3300031765|Ga0318554_10378368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium804Open in IMG/M
3300031781|Ga0318547_10487456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium761Open in IMG/M
3300031879|Ga0306919_10084937All Organisms → cellular organisms → Bacteria2191Open in IMG/M
3300031890|Ga0306925_10241283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-21948Open in IMG/M
3300031910|Ga0306923_12136427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae564Open in IMG/M
3300031910|Ga0306923_12439411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium517Open in IMG/M
3300031912|Ga0306921_10094468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3458Open in IMG/M
3300031912|Ga0306921_10315635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1829Open in IMG/M
3300031945|Ga0310913_10028797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3522Open in IMG/M
3300031946|Ga0310910_10518960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium946Open in IMG/M
3300031954|Ga0306926_10479956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1530Open in IMG/M
3300031954|Ga0306926_11814419All Organisms → cellular organisms → Bacteria → Proteobacteria692Open in IMG/M
3300031962|Ga0307479_11005255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium803Open in IMG/M
3300031981|Ga0318531_10194048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2915Open in IMG/M
3300032008|Ga0318562_10875267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium513Open in IMG/M
3300032039|Ga0318559_10106643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-21245Open in IMG/M
3300032042|Ga0318545_10392812Not Available501Open in IMG/M
3300032174|Ga0307470_10163424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1379Open in IMG/M
3300032770|Ga0335085_10010556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium13790Open in IMG/M
3300032829|Ga0335070_10562911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-21075Open in IMG/M
3300032829|Ga0335070_11871404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium542Open in IMG/M
3300032892|Ga0335081_10310379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2083Open in IMG/M
3300032897|Ga0335071_10954260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.805Open in IMG/M
3300032897|Ga0335071_11576368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae601Open in IMG/M
3300032954|Ga0335083_11042227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae642Open in IMG/M
3300033983|Ga0371488_0066112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2141Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.33%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut3.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.83%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.83%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.83%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.83%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011418Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_054436602170459017Switchgrass, Maize And Mischanthus LitterMFPAMGTTLHTFSERVLLTLAIGLLVACAANVALVWAFL
JGI12627J18819_10001990103300001867Forest SoilMGTMLHTFCERAQLTLAVGLLAACAANVALVWVFL*
Ga0066388_10141052723300005332Tropical Forest SoilMLRPMGTMLHTSCEGMHLKLALGLLMACAANVVLVCAFL*
Ga0066388_10416679623300005332Tropical Forest SoilMFPAMGTGVHTFSERTQLTLAVGLFVACMANVALVWAFL*
Ga0070709_1002552033300005434Corn, Switchgrass And Miscanthus RhizosphereMVLTMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL*
Ga0070741_10000314703300005529Surface SoilMGTWLHTFCERAQLTLAVGLLAACAANVALVWAFL*
Ga0070738_1000123443300005531Surface SoilMGTRLHTFCERVQLTLAVGLLVACAANVALVWVFL*
Ga0070739_1042013523300005532Surface SoilMVPAMGTILHTFCGRVQLTLAVGLLAACAANVALVWAFL*
Ga0070734_1001588163300005533Surface SoilMGTMLHTFCERVQLNLAIGLLMACAANVALVWAFL*
Ga0070735_1017635623300005534Surface SoilMVWAMGTTLQTASERMQLGLTIALLGACAANVALVWAFL*
Ga0066706_1007335653300005598SoilMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL*
Ga0066903_10071393223300005764Tropical Forest SoilMETTPYTFCERVQLTLAVGLFAACAANVALVFAFL*
Ga0066788_1006126133300005944SoilMFPAMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL*
Ga0066790_1004704513300005995SoilMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL*
Ga0075028_10001786743300006050WatershedsMGTTPHTASDRVQLSLTVALLAACAANVALVFAWL*
Ga0070716_10105748213300006173Corn, Switchgrass And Miscanthus RhizosphereMFPGMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL*
Ga0079221_1014280733300006804Agricultural SoilMGTTLHTFGERVQLTLAVGLLAACAANLALVWAFF*
Ga0075433_1152512213300006852Populus RhizosphereMGTMLHTARERVELTLAIALLIACAANVALVCAFL*
Ga0099794_1056972923300007265Vadose Zone SoilMFPAMGTTLHTFSERGIQLTLAIGLLVACAANVALVWAFP*
Ga0099829_1097573913300009038Vadose Zone SoilMFPAMGTTLHTFSERVQLTLAIGLLVACAANVALVWAFL*
Ga0099827_1003374953300009090Vadose Zone SoilMFPAMGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL*
Ga0066709_10046465043300009137Grasslands SoilMFPAMGSTLHTFCERIQLTLAIGLLVACAANVALVWDFL*
Ga0126374_1003432033300009792Tropical Forest SoilMFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI*
Ga0126374_1071996123300009792Tropical Forest SoilMLPAMETTLHTFCERVQLNLAIGLLIACAANVALVWSFL*
Ga0123355_1116433223300009826Termite GutMDTTPHTFCDRVQLSLAVGLFAACAANVVLVLVFL*
Ga0126380_1127990113300010043Tropical Forest SoilMGTGLRTFSERTQLSLAIGLFVACAANIALVLTFL*
Ga0126380_1153478823300010043Tropical Forest SoilMDTTPHTFCDRVQLTLAVGLFAACAANVVLVLVFL*
Ga0126373_1076423333300010048Tropical Forest SoilMFLLMEAMSRTFCERVQLTLAAGLFAACAANVALVWAFLF*
Ga0123356_1026718233300010049Termite GutMDTTPHTFCNRVQLSLAVGLFAACAANVVLVLVFL*
Ga0123356_1339111123300010049Termite GutPMDTTPHTFCDRVQLTLAVGLFAACAANVVLVLVFL*
Ga0123356_1347777113300010049Termite GutMVLPMDTTRPTFCDRVQLTLAVGLFAACAANVVLVFVFL*
Ga0099796_1052852723300010159Vadose Zone SoilMFPAMGTTLHTFSERGIQLTLAIGLLVACAANVALVWAFL*
Ga0126378_1340429113300010361Tropical Forest SoilMFPAMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL*
Ga0126377_1076055423300010362Tropical Forest SoilMGTTLHTASERVELTLAIGLLIACAANVALVCAFL*
Ga0126381_10166545923300010376Tropical Forest SoilMETTSRTFCERVQLTLAAGLFAACAANVALVWAFLF*
Ga0126381_10289517523300010376Tropical Forest SoilMFLPMETMSRTFSECVQLTLAAGLFAACAANVALVWAFLF*
Ga0126381_10320619633300010376Tropical Forest SoilMETTPYIFCERVQLTLAVGLFAACAANVALVFAFL*
Ga0126381_10373023913300010376Tropical Forest SoilMETMLHTFCERVQLPLAVGLFAACAANVALVWAFL*
Ga0126381_10493043513300010376Tropical Forest SoilMLPAMGTTLQTFCERVQLNLAIGLLMACTANVALVWAF
Ga0137392_1043288523300011269Vadose Zone SoilMGTTLHTFSERVQLTLAIALLVACAANVALVWAFL*
Ga0153954_100649523300011418Attine Ant Fungus GardensMETMNEIASERMHLRLTVGLLLACVANVALVCAFL*
Ga0137389_1025121323300012096Vadose Zone SoilMFPAMGTTLHAFSERVQLTLAIGLLVACAANVALVWAFL*
Ga0137383_10005810103300012199Vadose Zone SoilMFPAMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL*
Ga0137363_1025937533300012202Vadose Zone SoilMFPAMGTTLHTFSERGVRLTLAIGLLVACAANVALVWAFL*
Ga0137399_1019298713300012203Vadose Zone SoilMGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL*
Ga0137384_1059767023300012357Vadose Zone SoilMFPAMGSTLHTFSGRVQVTLAVALLVACAANVALVWAFL*
Ga0137385_1073848013300012359Vadose Zone SoilMGTTLHTFSERIQLTLAIALLVACAANVALVWAFL*
Ga0137397_1020525633300012685Vadose Zone SoilMFPSMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL*
Ga0137404_1042315613300012929Vadose Zone SoilMFSAMGTSLHTFSGRVQLTLAIGLLVACAANVALV
Ga0137407_1018299843300012930Vadose Zone SoilMFPSMGSTLHTFSERVRLTLAIALLVACAANVALVWAFL*
Ga0137407_1106740313300012930Vadose Zone SoilMFSAMGTSLHTFSGRVQLTLAIGLLVACAANVALVCAFL*
Ga0137407_1151052823300012930Vadose Zone SoilMGTTLHTFSERVQLTLAIALLVACAANVTLVWAFL*
Ga0137410_1002106973300012944Vadose Zone SoilMFPAMGTTLHTFSEHGVQLTLAIGLLVACAANVALVWAFL*
Ga0126369_1060889523300012971Tropical Forest SoilMGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL*
Ga0182035_1053796913300016341SoilRMFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0182035_1074241913300016341SoilMGTSLHTFCQRLQLNLAIGLLMACAANVALVWSFL
Ga0187785_1016123623300017947Tropical PeatlandMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFLS
Ga0187780_1146362023300017973Tropical PeatlandRRMVPPMGSMLHTFCERVQLTLAVGLLAACAANVALVWAFL
Ga0187784_1040654423300018062Tropical PeatlandMGTSLHSFCERVQLNLAIGLLMACAANVALVWAFL
Ga0187772_1001463053300018085Tropical PeatlandMGTGLHTFSERVQLNLAIGLLMACAANVALVWAFL
Ga0137408_118314233300019789Vadose Zone SoilMFPSMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL
Ga0179594_1000084023300020170Vadose Zone SoilMGTTLHTFSERGVQLTLAIGLLVACAANVALVWAFL
Ga0179594_1011392513300020170Vadose Zone SoilMFPAMGSTLHTFCERIQLTLAIGLLVACAANVALVWAFL
Ga0179592_1003315343300020199Vadose Zone SoilMGSTLHTFSERVQLTLAIALLVACAANVALVWAFL
Ga0210407_1000314853300020579SoilMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL
Ga0210403_1060559123300020580SoilMFPGMGTGLRTLSERTLLTLAVGLFIACVANVALVWAFL
Ga0179596_1004942043300021086Vadose Zone SoilMGTTLYTFSERVQLTLAIGLLVACAANVALVWAFL
Ga0179596_1023123713300021086Vadose Zone SoilMGTTLHTFSERVQLTLAIALLVACAANVALVWAFL
Ga0179596_1035843923300021086Vadose Zone SoilMFPAMGSTLHTFSGRVQMTLAVALLVACAANVALVWAFL
Ga0210406_1133726413300021168SoilMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL
Ga0213872_1036711413300021361RhizosphereLMVPSMESLFHTFCERAQLTLAVGLLAACAANIALVWAFL
Ga0213878_1024219623300021444Bulk SoilMLASMGTLLHTFCERAQLTLAVGLLAACAANVALVWAFL
Ga0210392_1024995213300021475SoilLTMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL
Ga0126371_10002917113300021560Tropical Forest SoilMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0126371_1018359743300021560Tropical Forest SoilMEATPYTFCERVQLTLAVGLFAACAANVALVFAFL
Ga0207684_1010806053300025910Corn, Switchgrass And Miscanthus RhizosphereMFPAMGTSLHTFSRRVQLTLAIGLLVACAANVALVWAFL
Ga0209849_102896523300026215SoilMFPAMGSTLHTFSERVQLTLAVALLAACAANVALVWTFL
Ga0209161_1019039533300026548SoilMFPAMGSTLHTFCERIQLTLAIGLLVACTANVALVWAFL
Ga0209622_106801623300027502Forest SoilMGTMLHTFCERVQLTLAVGLLAACAANVALVWVFL
Ga0209523_103135723300027548Forest SoilMGNLLHTFCERAQLTLAVGLFAACAANVALVWAFL
Ga0209178_142082223300027725Agricultural SoilMGTTLHTFGERVQLTLAVGLLAACAANLALVWAFF
Ga0209656_1049640313300027812Bog Forest SoilMETMPHTFCERVQLTLALGLLAACAANVALVWVFL
Ga0209060_1001660333300027826Surface SoilMGTMLHTFCERVQLNLAIGLLMACAANVALVWAFL
Ga0209060_1002843843300027826Surface SoilMGTRLHTFCERVQLTLAVGLLVACAANVALVWVFL
Ga0209060_1013658133300027826Surface SoilMGTMLHTFCERVQVNLAIGLLMACAANVALVWAFL
Ga0209579_1019514123300027869Surface SoilMFLRMGTLLHTFCERAQLTLAVGLLAGCAANVALVWAFL
Ga0209068_1009334033300027894WatershedsMGTTPHTASDRVQLSLTVALLAACAANVALVFAWL
Ga0209062_100767773300027965Surface SoilMGTWLHTFCERAQLTLAVGLLAACAANVALVWAFL
Ga0265340_1005321843300031247RhizosphereMVAGMGTMLHTFCERVQLTLAIGLLMACAANVVLVCAFL
Ga0318516_1037864023300031543SoilAPPMGTMLHTSCEGMHLKLALGLLIACAANVALVCAFL
Ga0318534_1031289723300031544SoilMGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL
Ga0307476_1000434123300031715Hardwood Forest SoilMGTMLHTFCERAQLTLAVGLLAACAANVALVWVFL
Ga0306917_1062360523300031719SoilMFPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0307477_1039452923300031753Hardwood Forest SoilMGNLLHTFCERAQLTLAAGLLAACAANVALVWAFL
Ga0318554_1037836833300031765SoilPVMERMLHTFCERVQLPLAVALFAACAANVVLVWAFL
Ga0318547_1048745623300031781SoilMERILHTFCERVQLPLAVALFAACAANVALVWAFL
Ga0306919_1008493733300031879SoilMGTMLHTSCEGMHLKLALGLLIACAANVALVCAFL
Ga0306925_1024128333300031890SoilMERMLHTFCERVQLPLAVALFAACAANVALVWAFL
Ga0306923_1213642723300031910SoilMGTTLHTFCGRVQLTLAAGLLAACLANAALVWAHL
Ga0306923_1243941123300031910SoilCRMGTSLHTFCQRVQLNLAIGLLMACAANVALVWSFL
Ga0306921_1009446863300031912SoilMGTMLHTSCEGMQLKLALGLLMACAANVALVCAFL
Ga0306921_1031563533300031912SoilMFPDMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0310913_1002879723300031945SoilMGTMLHTSCEGMHLKLALGLLIACAANVVLVCAFL
Ga0310910_1051896023300031946SoilMFPGMGTGLRTFSERTLLTLAIGLFIACVANVALVWAFI
Ga0306926_1047995633300031954SoilPGMGTGLRTFSERTLLTLAIGLFIACAANVALVWAFI
Ga0306926_1181441923300031954SoilMFPAMGTSLHTFCERVQFHLAIGLFVACAANVALVWSFL
Ga0307479_1100525523300031962Hardwood Forest SoilMLPAMETTLHTFCERVQLNLAIGLLIACAANVALVWSFL
Ga0318531_1019404823300031981SoilMERMLHTFCERVQLPLAVALFAACAANVVLVWAFL
Ga0318562_1087526723300032008SoilMETLFHTFCERAQLTLAVGLLAACAANVALVWAFL
Ga0318559_1010664313300032039SoilMERILHTFCERVQLPLAVALFAACAANVVLVWAFL
Ga0318545_1039281223300032042SoilMERTLHTFCERVQLPLAVALFAACAANVALVWAFL
Ga0307470_1016342443300032174Hardwood Forest SoilMVLAMGTGLHTFCERTQLTLAIGLFVACAANVALVLAFL
Ga0335085_1001055653300032770SoilMVLPMGTLRHSSCELVQLTLAIGLLAACAANIALVWAFL
Ga0335070_1056291123300032829SoilMGTLLQTFCKRAQLTLAIGLLAGCAANVVLVWAFL
Ga0335070_1187140413300032829SoilMGSMLHTFCERVQLTLAVGLLAACAANVVLVWAFL
Ga0335081_1031037933300032892SoilMGTTLHTFCGRVQLNLAIGLLMACTANVALVWAFL
Ga0335071_1095426023300032897SoilMGTLLHTFCERVQLTLVVGLAAACAANVALVWVFL
Ga0335071_1157636823300032897SoilMGTLHHTFCEHVQLTLAVGLLAACAANVALVCLFL
Ga0335083_1104222723300032954SoilMVLPMGTGLQTFSGRTQLTLAIGLFAACAANVALVLVFL
Ga0371488_0066112_803_9223300033983Peat SoilMFPAMGTMLHTSSERVQLTLTVGLLVACAANVALVLAFL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.