Basic Information | |
---|---|
Family ID | F073936 |
Family Type | Metagenome |
Number of Sequences | 120 |
Average Sequence Length | 37 residues |
Representative Sequence | MTGRAFFAMLIFVGFVVAVMWFAVLPALTTFRPTLP |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 44.17 % |
% of genes near scaffold ends (potentially truncated) | 15.83 % |
% of genes from short scaffolds (< 2000 bps) | 61.67 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.167 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF00892 | EamA | 29.17 |
PF13602 | ADH_zinc_N_2 | 21.67 |
PF08768 | THAP4_heme-bd | 10.83 |
PF02735 | Ku | 5.00 |
PF00106 | adh_short | 3.33 |
PF00571 | CBS | 2.50 |
PF07920 | DUF1684 | 2.50 |
PF02574 | S-methyl_trans | 1.67 |
PF01642 | MM_CoA_mutase | 0.83 |
PF07690 | MFS_1 | 0.83 |
PF04607 | RelA_SpoT | 0.83 |
PF00682 | HMGL-like | 0.83 |
PF14333 | DUF4389 | 0.83 |
PF10604 | Polyketide_cyc2 | 0.83 |
PF14329 | DUF4386 | 0.83 |
PF00005 | ABC_tran | 0.83 |
PF13683 | rve_3 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 5.00 |
COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 2.50 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 1.67 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 1.67 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.33 % |
Unclassified | root | N/A | 1.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001086|JGI12709J13192_1000410 | All Organisms → cellular organisms → Bacteria | 7894 | Open in IMG/M |
3300001145|JGI12682J13319_1008781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
3300001661|JGI12053J15887_10007316 | All Organisms → cellular organisms → Bacteria | 5930 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100099628 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101591122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
3300002560|JGI25383J37093_10137142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
3300005178|Ga0066688_10005141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5937 | Open in IMG/M |
3300005540|Ga0066697_10008207 | All Organisms → cellular organisms → Bacteria | 5255 | Open in IMG/M |
3300005540|Ga0066697_10014236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4184 | Open in IMG/M |
3300005540|Ga0066697_10035323 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
3300005540|Ga0066697_10119880 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300005542|Ga0070732_10621494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
3300005552|Ga0066701_10004941 | All Organisms → cellular organisms → Bacteria | 5459 | Open in IMG/M |
3300005552|Ga0066701_10100507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1688 | Open in IMG/M |
3300005552|Ga0066701_10131392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1492 | Open in IMG/M |
3300005554|Ga0066661_10041842 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
3300005554|Ga0066661_10401013 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300005555|Ga0066692_10201312 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300005556|Ga0066707_10116068 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
3300005557|Ga0066704_10049203 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300005557|Ga0066704_10342326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1004 | Open in IMG/M |
3300005559|Ga0066700_10055212 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
3300005559|Ga0066700_10701993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8 | 694 | Open in IMG/M |
3300005561|Ga0066699_10005982 | All Organisms → cellular organisms → Bacteria | 5479 | Open in IMG/M |
3300005574|Ga0066694_10043045 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300005598|Ga0066706_10145674 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
3300006041|Ga0075023_100034695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1505 | Open in IMG/M |
3300006173|Ga0070716_100154266 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300006173|Ga0070716_101227659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
3300006804|Ga0079221_10401861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
3300007258|Ga0099793_10182755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1002 | Open in IMG/M |
3300007258|Ga0099793_10285645 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300007265|Ga0099794_10306201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
3300007788|Ga0099795_10306669 | Not Available | 700 | Open in IMG/M |
3300007982|Ga0102924_1000958 | All Organisms → cellular organisms → Bacteria | 34416 | Open in IMG/M |
3300007982|Ga0102924_1035847 | All Organisms → cellular organisms → Bacteria | 3166 | Open in IMG/M |
3300009038|Ga0099829_10441092 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300009038|Ga0099829_11316755 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009089|Ga0099828_10128013 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
3300009090|Ga0099827_10007502 | All Organisms → cellular organisms → Bacteria | 6783 | Open in IMG/M |
3300009090|Ga0099827_10011003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5853 | Open in IMG/M |
3300009090|Ga0099827_10519831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1023 | Open in IMG/M |
3300009090|Ga0099827_11343004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
3300009137|Ga0066709_104005499 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300010303|Ga0134082_10006559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4159 | Open in IMG/M |
3300011271|Ga0137393_10102571 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
3300011401|Ga0153984_1058850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
3300012096|Ga0137389_10096520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2341 | Open in IMG/M |
3300012198|Ga0137364_10226172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1377 | Open in IMG/M |
3300012198|Ga0137364_10332396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1132 | Open in IMG/M |
3300012198|Ga0137364_11415008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
3300012199|Ga0137383_10224132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1378 | Open in IMG/M |
3300012203|Ga0137399_10228010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1521 | Open in IMG/M |
3300012205|Ga0137362_11785400 | Not Available | 502 | Open in IMG/M |
3300012206|Ga0137380_10319637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1388 | Open in IMG/M |
3300012208|Ga0137376_10058164 | All Organisms → cellular organisms → Bacteria | 3182 | Open in IMG/M |
3300012208|Ga0137376_10474732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1085 | Open in IMG/M |
3300012209|Ga0137379_10267272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1622 | Open in IMG/M |
3300012210|Ga0137378_10652718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 963 | Open in IMG/M |
3300012354|Ga0137366_10852713 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012357|Ga0137384_10960860 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012683|Ga0137398_10623467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 747 | Open in IMG/M |
3300012683|Ga0137398_10843862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
3300012918|Ga0137396_10141970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8 | 1744 | Open in IMG/M |
3300012977|Ga0134087_10430457 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300014150|Ga0134081_10257394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
3300018431|Ga0066655_10018671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3189 | Open in IMG/M |
3300018431|Ga0066655_10058711 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300018431|Ga0066655_10652902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
3300018431|Ga0066655_10944435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
3300018433|Ga0066667_10091226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1997 | Open in IMG/M |
3300018433|Ga0066667_10217137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1421 | Open in IMG/M |
3300018468|Ga0066662_10092908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2108 | Open in IMG/M |
3300018468|Ga0066662_10163080 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
3300018468|Ga0066662_10273616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1398 | Open in IMG/M |
3300018482|Ga0066669_11378638 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300019888|Ga0193751_1261665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
3300020581|Ga0210399_10396054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1152 | Open in IMG/M |
3300021046|Ga0215015_10108434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5141 | Open in IMG/M |
3300021046|Ga0215015_10297238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1611 | Open in IMG/M |
3300021046|Ga0215015_10603066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1333 | Open in IMG/M |
3300021046|Ga0215015_10661355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1348 | Open in IMG/M |
3300021432|Ga0210384_10622372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 969 | Open in IMG/M |
3300022557|Ga0212123_10006365 | All Organisms → cellular organisms → Bacteria | 19728 | Open in IMG/M |
3300022557|Ga0212123_10747326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8 | 595 | Open in IMG/M |
3300025910|Ga0207684_10000007 | All Organisms → cellular organisms → Bacteria | 612969 | Open in IMG/M |
3300025922|Ga0207646_10000082 | All Organisms → cellular organisms → Bacteria | 127736 | Open in IMG/M |
3300025922|Ga0207646_10007561 | All Organisms → cellular organisms → Bacteria | 11014 | Open in IMG/M |
3300025928|Ga0207700_11611612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300026295|Ga0209234_1144835 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300026296|Ga0209235_1287037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300026298|Ga0209236_1035286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2629 | Open in IMG/M |
3300026300|Ga0209027_1049529 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300026315|Ga0209686_1020332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2645 | Open in IMG/M |
3300026318|Ga0209471_1015345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3929 | Open in IMG/M |
3300026318|Ga0209471_1182322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
3300026323|Ga0209472_1046489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1891 | Open in IMG/M |
3300026328|Ga0209802_1050336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2066 | Open in IMG/M |
3300026332|Ga0209803_1027317 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
3300026332|Ga0209803_1321035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300026334|Ga0209377_1203319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
3300026499|Ga0257181_1103614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
3300026530|Ga0209807_1080154 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300026551|Ga0209648_10454483 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300027521|Ga0209524_1013808 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300027537|Ga0209419_1001379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3080 | Open in IMG/M |
3300027587|Ga0209220_1000639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10956 | Open in IMG/M |
3300027633|Ga0208988_1118277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 651 | Open in IMG/M |
3300027645|Ga0209117_1015918 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
3300027651|Ga0209217_1005373 | All Organisms → cellular organisms → Bacteria | 4265 | Open in IMG/M |
3300027651|Ga0209217_1015644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2463 | Open in IMG/M |
3300027667|Ga0209009_1000019 | All Organisms → cellular organisms → Bacteria | 84700 | Open in IMG/M |
3300027674|Ga0209118_1049748 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300027727|Ga0209328_10097168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8 | 900 | Open in IMG/M |
3300027846|Ga0209180_10607042 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300027882|Ga0209590_10011887 | All Organisms → cellular organisms → Bacteria | 4121 | Open in IMG/M |
3300028536|Ga0137415_10006192 | All Organisms → cellular organisms → Bacteria | 11840 | Open in IMG/M |
3300031962|Ga0307479_10000766 | All Organisms → cellular organisms → Bacteria | 29286 | Open in IMG/M |
3300031962|Ga0307479_10022165 | All Organisms → cellular organisms → Bacteria | 6009 | Open in IMG/M |
3300031962|Ga0307479_10081695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3128 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.17% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.17% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
3300001145 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011401 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12709J13192_10004106 | 3300001086 | Forest Soil | MTGRTFFAMLIFAGMIGAVMWFFVLPAMTTYRPALP* |
JGI12682J13319_10087814 | 3300001145 | Forest Soil | MYRGDEYVNGRTFFTMLLFAGMIGAVMWFFVLPAL |
JGI12053J15887_100073163 | 3300001661 | Forest Soil | MTGRAFFAMLIFVGFVVAVMWFAVLPALTTFRPTLP* |
JGIcombinedJ26739_1000996285 | 3300002245 | Forest Soil | MTXRTFFTMLIFVGFVVAVMWFAVLPALTTYRPTLP* |
JGIcombinedJ26739_1015911222 | 3300002245 | Forest Soil | MTGRTMFSMLIFVGIIVAAMWFFILPVLTTFKPTLP* |
JGI25383J37093_101371422 | 3300002560 | Grasslands Soil | VTDEMTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0066688_100051419 | 3300005178 | Soil | LMWVQSGRRGSDMTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP* |
Ga0066697_100082076 | 3300005540 | Soil | MTGRTLVAMLTFGGIVVAVMWFFVLPALTTFKPTLP* |
Ga0066697_100142364 | 3300005540 | Soil | MTGRTLFAMLTFAGIVVAMMWFFVLPALTTFRPTLP* |
Ga0066697_100353235 | 3300005540 | Soil | MTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP* |
Ga0066697_101198802 | 3300005540 | Soil | MTGRTLIAMLTFAGIVVAVMWFFVLPALTTFRPTLP* |
Ga0070732_106214942 | 3300005542 | Surface Soil | LNSLGGSDMTGRSLFSMLIFAGIIVAVMWFFVLPALTTFRPTLP* |
Ga0066701_100049413 | 3300005552 | Soil | MTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0066701_101005072 | 3300005552 | Soil | MTGRTLFAMLAFAGIVVGVMWFFVLPALTTFRPTLP* |
Ga0066701_101313924 | 3300005552 | Soil | MTARTFFAMVIFAGMIGAVMWFFVLPALTTYKPSLP* |
Ga0066661_100418425 | 3300005554 | Soil | MTGRPIFSMLIFVGIIVAAMWFFVLPALTTFRPALP* |
Ga0066661_104010132 | 3300005554 | Soil | MTGRAFFSMLIFVGFVVAIMWFAVLPSLTTFRPTLP* |
Ga0066692_102013123 | 3300005555 | Soil | DMTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP* |
Ga0066707_101160682 | 3300005556 | Soil | MTGRTFFTMLIFVGFVVLVMWFAVLPALTTFRPTLP* |
Ga0066704_100492035 | 3300005557 | Soil | MTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP* |
Ga0066704_103423262 | 3300005557 | Soil | MTGRTFFAMLMFAGMIGAVMWFFVLPALTTYRPSLP* |
Ga0066700_100552121 | 3300005559 | Soil | MTGRTLFAMLMFAGIVVAVMWFFVLPALTTFRPTLP* |
Ga0066700_107019932 | 3300005559 | Soil | MTGRAFFSMLIFVGFVVAVMWFAVLPALTTFRPTLP* |
Ga0066699_100059827 | 3300005561 | Soil | MTGRPLFSMLIFAGIIVAAMWFFVLPALTTFRPTLP* |
Ga0066694_100430452 | 3300005574 | Soil | MTGRAFFSMLIFVGFVVAVMWFVVLPSLTTFRPTLP* |
Ga0066706_101456741 | 3300005598 | Soil | VQSGRRGSDMTGRPIFSMLIFVGIIVAAMWFFVLPALTTFRPALP* |
Ga0075023_1000346952 | 3300006041 | Watersheds | VTSRTFFAMLMFAAIIGAVMWFFVLPALTTYRPSVP* |
Ga0070716_1001542663 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTARTFFAMLIFAGIIGVVMWFLVLPALTTYRPSLP* |
Ga0070716_1012276591 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARAFFSMLIFVGFVVFVMWFAVLPALTTFRPTLP* |
Ga0079221_104018611 | 3300006804 | Agricultural Soil | GRSLFSMLIFAGIIVAAMWFFVLPALTTYRPTLP* |
Ga0099793_101827555 | 3300007258 | Vadose Zone Soil | MTSRTFFAMLMFAGMIGAVMWFFVLPALTTYRPSLP* |
Ga0099793_102856452 | 3300007258 | Vadose Zone Soil | MTGRAFFSMLIFVGFVVVVMWFAVLPALTTLRPTLP* |
Ga0099794_103062012 | 3300007265 | Vadose Zone Soil | MTGRAFFSMLIFVGFVVAVMWFAVLPSLTTFRPTLP* |
Ga0099795_103066691 | 3300007788 | Vadose Zone Soil | MTSRTFFAMLMFAGLIGAVMWFFVLPALTVYRPGIP* |
Ga0102924_100095818 | 3300007982 | Iron-Sulfur Acid Spring | MTGRTFFAMLMFAGMIGAVIWFFVLPALTTYKPSLP* |
Ga0102924_10358476 | 3300007982 | Iron-Sulfur Acid Spring | MTGRAFFAMLIFAGLVVAVMWFAVLPSLTTFKPTLP* |
Ga0099829_104410922 | 3300009038 | Vadose Zone Soil | MTGRTFVTMLIFVGFVVVVMWFAVLPALTTFKPTLP* |
Ga0099829_113167552 | 3300009038 | Vadose Zone Soil | MTGRAFFSMLIFVAFVVFVMWLAVLPALTTFRPTLP* |
Ga0099828_101280132 | 3300009089 | Vadose Zone Soil | MTGRAFFSMLIFVAFVVFVMWFAVLPALTTFRPTLP* |
Ga0099827_100075025 | 3300009090 | Vadose Zone Soil | MTARTLFAMVIFAGMIGAVMWFFVLPALTTYKPSLP* |
Ga0099827_100110037 | 3300009090 | Vadose Zone Soil | MTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0099827_105198311 | 3300009090 | Vadose Zone Soil | EMTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0099827_113430042 | 3300009090 | Vadose Zone Soil | MTGRAFFAMLIFVGFVVAVMWFAVLPSLTTFRPTLP* |
Ga0066709_1040054992 | 3300009137 | Grasslands Soil | MTGRTFFTMLIFVGFVVVVMWFAVLPSLTTFRPTLP* |
Ga0134082_100065597 | 3300010303 | Grasslands Soil | DMTGRTLVAMLTFGGIVVAVTWFFVLPALTTFKPTLP* |
Ga0137393_101025712 | 3300011271 | Vadose Zone Soil | MTGRTFLTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0153984_10588502 | 3300011401 | Attine Ant Fungus Gardens | VTTRTFFAMLIFAGIIGVVMWFLVLPALTTYRPSLP* |
Ga0137389_100965204 | 3300012096 | Vadose Zone Soil | MTGRAFFSMLIFVGFVVFVMWFAVLPALTTFRPTLP* |
Ga0137364_102261723 | 3300012198 | Vadose Zone Soil | MTGRTFFTMLIFVGFVVVVMWFAVLPALTSFRPTLP* |
Ga0137364_103323963 | 3300012198 | Vadose Zone Soil | FDITGRTLFAMLTFAGIVVAVMWFFVLPALTTFRPTVP* |
Ga0137364_114150081 | 3300012198 | Vadose Zone Soil | ERREMTGRAFFSMLIFVGFVVAVMWFVVLPSLTTFRPTLP* |
Ga0137383_102241322 | 3300012199 | Vadose Zone Soil | MTVRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0137399_102280102 | 3300012203 | Vadose Zone Soil | MTGRAFFAMLIFAGFVVAVMWFAVLPSLTTFRPTLP* |
Ga0137362_117854002 | 3300012205 | Vadose Zone Soil | MTGRTFFAMLMFAGMIGAVMWFFVLPALTTYKPSLP* |
Ga0137380_103196372 | 3300012206 | Vadose Zone Soil | VTGRTLIAMRTFAGIVVAVMWFFVLPALTTFRPTLP* |
Ga0137376_100581642 | 3300012208 | Vadose Zone Soil | MTGRTLLAMLTFAGIVVAAMWFFVLPALTTFRPTLP* |
Ga0137376_104747323 | 3300012208 | Vadose Zone Soil | EMTGRAFFSMLIFVGFVVAIMWFAVLPSLTTFRPTLP* |
Ga0137379_102672722 | 3300012209 | Vadose Zone Soil | MTGRTFFTMLIFVGFVVVVMWFAVLPALTTYRPALP* |
Ga0137378_106527181 | 3300012210 | Vadose Zone Soil | REMTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0137366_108527132 | 3300012354 | Vadose Zone Soil | MTGRTFFTMLIFVAFVVVVMWFAVLPALTTFRPTLP* |
Ga0137384_109608602 | 3300012357 | Vadose Zone Soil | MTGRAFFSMLIFVRFVVAIMWFAVLPSLTTFRPTLP* |
Ga0137398_106234672 | 3300012683 | Vadose Zone Soil | MTGRAFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP* |
Ga0137398_108438621 | 3300012683 | Vadose Zone Soil | MTSRTFFAMLMFAGMIGAVMWFFVLPALTVYRPGIP* |
Ga0137396_101419702 | 3300012918 | Vadose Zone Soil | MTGRAFFSMLIFVGFVVVVMWFAVLPALTTFRPTLP* |
Ga0134087_104304571 | 3300012977 | Grasslands Soil | MTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRQTLP* |
Ga0134081_102573942 | 3300014150 | Grasslands Soil | EIDMTGRTLVAMLTFGGIVVAVMWFFVLPALTTFKPTLP* |
Ga0066655_100186714 | 3300018431 | Grasslands Soil | MTGRTLVAMLTFGGIVVAVMWFFVLPALTTFKPTLP |
Ga0066655_100587116 | 3300018431 | Grasslands Soil | MTGRTLFAMLTFAGIVVAMMWFFVLPALTTFRPTLP |
Ga0066655_106529021 | 3300018431 | Grasslands Soil | ISVSPAQVTGRAFFAMLIFVGFVVVVMWFAVLPALTTFRPTLP |
Ga0066655_109444352 | 3300018431 | Grasslands Soil | MTGRTLIAMLTFAGIVVAVMWFFVLPALTTFRPTLP |
Ga0066667_100912263 | 3300018433 | Grasslands Soil | MTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP |
Ga0066667_102171372 | 3300018433 | Grasslands Soil | MTGRPIFSMLIFVGIIVAAMWFFVLPALTTFRPALP |
Ga0066662_100929084 | 3300018468 | Grasslands Soil | MTGRTLFAMLAFAGIVVGVMWFFVLPALTTFRPTLP |
Ga0066662_101630803 | 3300018468 | Grasslands Soil | ERREMTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP |
Ga0066662_102736162 | 3300018468 | Grasslands Soil | MTARTFFAMVIFAGMIGAVMWFFVLPALTTYKPSLP |
Ga0066669_113786382 | 3300018482 | Grasslands Soil | MTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP |
Ga0193751_12616653 | 3300019888 | Soil | MTARTFFAMLMFAGIIGVVMWFFVLPALTTYRPSVP |
Ga0210399_103960542 | 3300020581 | Soil | VTTRTFFAMLVFAGIIGVVMWFLVLPALTTYRPSLP |
Ga0215015_101084344 | 3300021046 | Soil | MTGRTFLTMLVFVGFVVVVMWFAVLPALTTFRPTLP |
Ga0215015_102972384 | 3300021046 | Soil | MTGRTLFAMLTFAGIVVAVMWFFVLPALTTFRPTLP |
Ga0215015_106030662 | 3300021046 | Soil | MTGRTFFAMLMFAGLIGIVMWFLVLPALTTYRPSVP |
Ga0215015_106613552 | 3300021046 | Soil | MYQRDEYVKSRTFFALLMFAGIIGAVMWFFVLPALSTYRPSVP |
Ga0210384_106223722 | 3300021432 | Soil | MYQGDEYVTSRTFFAMLMFAGVIGAVMWFFVLPALTTYRPSVP |
Ga0212123_1000636518 | 3300022557 | Iron-Sulfur Acid Spring | MTGRTFFAMLMFAGMIGAVIWFFVLPALTTYKPSLP |
Ga0212123_107473262 | 3300022557 | Iron-Sulfur Acid Spring | RYIQEMTGRAFFAMLIFAGLVVAVMWFAVLPSLTTFKPTLP |
Ga0207684_10000007142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGRPLFSMLIFAGIVVAVMWFFVLPALTTFKPTLP |
Ga0207646_1000008267 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGRTFFAMLFFAGLIAIVMWLFILPALTTYRPTLA |
Ga0207646_1000756115 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGRTFFIMLVFAGTIGTVMWFFILPALTVYRPALP |
Ga0207700_116116122 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTARTFFAMLIFAGIIGVVMWFLVLPALTTYRPSLP |
Ga0209234_11448352 | 3300026295 | Grasslands Soil | MTGRAFFSMLIFVGFVVAIMWFAVLPSLTTFRPTLP |
Ga0209235_12870372 | 3300026296 | Grasslands Soil | VTDEMTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP |
Ga0209236_10352862 | 3300026298 | Grasslands Soil | MTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP |
Ga0209027_10495292 | 3300026300 | Grasslands Soil | MTGRTFFAMLIFAGFVVVVMWLFVLPALTTYRPSLP |
Ga0209686_10203326 | 3300026315 | Soil | MTGRTLFAMLMFAGIVVAVMWFFVLPALTTFRPTLP |
Ga0209471_10153455 | 3300026318 | Soil | MTSRTFFAMLMFAGMIGAVMWFFVLPALTTYRPSLP |
Ga0209471_11823222 | 3300026318 | Soil | MTGRPLFSMLIFAGIIVAAMWFFVLPALTTFRPTLP |
Ga0209472_10464893 | 3300026323 | Soil | MTGRAFFSMLIFVGFVVAVMWFVVLPSLTTFRPTLP |
Ga0209802_10503363 | 3300026328 | Soil | MTGRTLFAMLTFAGIVVGVMWFFVLPALTTFRPTLP |
Ga0209803_10273171 | 3300026332 | Soil | EGIEMTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP |
Ga0209803_13210351 | 3300026332 | Soil | RSEFEMTGRTLFAMLMFAGIVVAVMWFFVLPALTTFRPTLP |
Ga0209377_12033191 | 3300026334 | Soil | DMTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP |
Ga0257181_11036142 | 3300026499 | Soil | MTGRTFLTMLIFVGFVVVVMWFAVLPALRTFRPTLP |
Ga0209807_10801541 | 3300026530 | Soil | MTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP |
Ga0209648_104544831 | 3300026551 | Grasslands Soil | MTSRAFFAMLIFVGFVVAVMWFAVLPSLTTFRPTLP |
Ga0209524_10138085 | 3300027521 | Forest Soil | MTGRTFFAMLIFAGMIGAVMWFFVLPAMTTYRPALP |
Ga0209419_10013793 | 3300027537 | Forest Soil | VTGRTFFTMLLFAGMIGAVMWFFILPALTTYRPSLP |
Ga0209220_10006395 | 3300027587 | Forest Soil | MTGRAFFSMLIFLGFVVGVMWFAILPALTTFRPTLP |
Ga0208988_11182772 | 3300027633 | Forest Soil | MTGRAFFAMLIFVGFVVAVMWFAVLPALTTFRPTLP |
Ga0209117_10159185 | 3300027645 | Forest Soil | MTSRAFFAMLIFAGMIGAVMWFFVLPALTVYQPAIP |
Ga0209217_10053733 | 3300027651 | Forest Soil | MTGRAFFSMLIFVGFVVGVMWFAILPALTTFRPTLP |
Ga0209217_10156444 | 3300027651 | Forest Soil | MTGRAFFAMLIFVGFVVAVMWFAVLPSLTTFRPTLP |
Ga0209009_100001941 | 3300027667 | Forest Soil | MYRGDEYVNGRTFFTMLLFAGMIGAVMWFFILPALTTYRPSLP |
Ga0209118_10497482 | 3300027674 | Forest Soil | MTGRAFFAMLVFVGFVVAVMWFAVLPSLTTFRPTLP |
Ga0209328_100971682 | 3300027727 | Forest Soil | MTGRAFFSMLIFVAFVVVVMWFAVLPALTTFRPTLP |
Ga0209180_106070422 | 3300027846 | Vadose Zone Soil | MTGRTFVTMLIFVGFVVVVMWFAVLPALTTFKPTLP |
Ga0209590_100118877 | 3300027882 | Vadose Zone Soil | MTARTLFAMVIFAGMIGAVMWFFVLPALTTYKPSLP |
Ga0137415_1000619210 | 3300028536 | Vadose Zone Soil | MTSRTFFAMLMFAGLIGAVMWFFVLPALTVYRPGIP |
Ga0307479_100007667 | 3300031962 | Hardwood Forest Soil | MTGRTMFSMLIFAGIIVAAMWFFILPVLTTFKPTLP |
Ga0307479_100221657 | 3300031962 | Hardwood Forest Soil | MTGRSLFSMLIFAGIIVTVMWFFVLPALTTFRPTLP |
Ga0307479_100816952 | 3300031962 | Hardwood Forest Soil | MTARAFFSMLIFVGFVVFVMWFAVLPALTTFRPTLP |
⦗Top⦘ |