NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074455

Metagenome Family F074455

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074455
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 38 residues
Representative Sequence LLIEPDARERVEKAIVEAGGEVLPMTIDRQGVQVVSR
Number of Associated Samples 100
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.52 %
% of genes near scaffold ends (potentially truncated) 97.48 %
% of genes from short scaffolds (< 2000 bps) 89.08 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.756 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(29.412 % of family members)
Environment Ontology (ENVO) Unclassified
(36.134 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.538 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF11006DUF2845 3.36
PF06762LMF1 2.52
PF14329DUF4386 2.52
PF00044Gp_dh_N 1.68
PF07238PilZ 1.68
PF03932CutC 1.68
PF02800Gp_dh_C 1.68
PF01512Complex1_51K 0.84
PF11026DUF2721 0.84
PF01103Omp85 0.84
PF08818DUF1801 0.84
PF01931NTPase_I-T 0.84
PF00162PGK 0.84
PF02517Rce1-like 0.84
PF14534DUF4440 0.84
PF13751DDE_Tnp_1_6 0.84
PF10129OpgC_C 0.84
PF01625PMSR 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 3.36
COG3142Copper homeostasis protein CutCInorganic ion transport and metabolism [P] 1.68
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 0.84
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.84
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.84
COG1894NADH:ubiquinone oxidoreductase, NADH-binding 51 kD subunit (chain F)Energy production and conversion [C] 0.84
COG1986Non-canonical (house-cleaning) NTP pyrophosphatase, all-alpha NTP-PPase familyDefense mechanisms [V] 0.84
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.84
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.84
COG4656Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfC subunitEnergy production and conversion [C] 0.84
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.84
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.76 %
UnclassifiedrootN/A9.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_103733490Not Available502Open in IMG/M
3300000789|JGI1027J11758_12630511All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300001356|JGI12269J14319_10211661All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005538|Ga0070731_11066587Not Available534Open in IMG/M
3300005712|Ga0070764_11057653All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005921|Ga0070766_10426075All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300005993|Ga0080027_10114833All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300006041|Ga0075023_100356844All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300007076|Ga0075435_100137189All Organisms → cellular organisms → Bacteria2050Open in IMG/M
3300007265|Ga0099794_10531860All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300009088|Ga0099830_10276601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1335Open in IMG/M
3300009088|Ga0099830_10477613All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300009088|Ga0099830_11012362All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300009088|Ga0099830_11710105All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300009089|Ga0099828_10539735All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300009089|Ga0099828_10757004Not Available871Open in IMG/M
3300009143|Ga0099792_10355490All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300009143|Ga0099792_10718324All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010043|Ga0126380_10901596Not Available734Open in IMG/M
3300010047|Ga0126382_11428361All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010048|Ga0126373_10108891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2575Open in IMG/M
3300010048|Ga0126373_10154085All Organisms → cellular organisms → Bacteria2187Open in IMG/M
3300010360|Ga0126372_12317557Not Available587Open in IMG/M
3300010366|Ga0126379_12956528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300010376|Ga0126381_101180808All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300010398|Ga0126383_10584365All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300011269|Ga0137392_10208659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1600Open in IMG/M
3300011269|Ga0137392_10425031All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300011270|Ga0137391_10852019All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300011271|Ga0137393_10604836All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300012096|Ga0137389_10340154All Organisms → cellular organisms → Bacteria → Acidobacteria1276Open in IMG/M
3300012096|Ga0137389_11613293All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012199|Ga0137383_10752992All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012200|Ga0137382_11268158All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300012205|Ga0137362_10956972Not Available730Open in IMG/M
3300012205|Ga0137362_11307006All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300012207|Ga0137381_11136080All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300012210|Ga0137378_11136820All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300012357|Ga0137384_11211575All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012359|Ga0137385_10788738All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300012362|Ga0137361_11400688All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012363|Ga0137390_10077177All Organisms → cellular organisms → Bacteria → Acidobacteria3269Open in IMG/M
3300012363|Ga0137390_10116245All Organisms → cellular organisms → Bacteria → Acidobacteria2648Open in IMG/M
3300012918|Ga0137396_10394034All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300012929|Ga0137404_10316537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1357Open in IMG/M
3300012929|Ga0137404_10571224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1015Open in IMG/M
3300012930|Ga0137407_12435480All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012961|Ga0164302_10941059All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300013308|Ga0157375_13500063All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300014200|Ga0181526_10429232All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300014657|Ga0181522_10611795All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300014968|Ga0157379_10339592All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300015054|Ga0137420_1160962All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300015264|Ga0137403_10237489All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300016294|Ga0182041_10015072All Organisms → cellular organisms → Bacteria → Acidobacteria4559Open in IMG/M
3300016294|Ga0182041_10566545All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300017823|Ga0187818_10031404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2279Open in IMG/M
3300017995|Ga0187816_10575125All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300018034|Ga0187863_10764484Not Available547Open in IMG/M
3300018043|Ga0187887_10048747All Organisms → cellular organisms → Bacteria2610Open in IMG/M
3300018058|Ga0187766_10782673All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300018086|Ga0187769_10570828All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300018088|Ga0187771_10674004All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300018090|Ga0187770_10953808All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300020010|Ga0193749_1016316All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300020581|Ga0210399_11203412All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300020582|Ga0210395_10982126All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300021168|Ga0210406_10186470All Organisms → cellular organisms → Bacteria → Acidobacteria1726Open in IMG/M
3300021405|Ga0210387_10612120All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300021406|Ga0210386_10646962All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300021406|Ga0210386_10964158All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300021432|Ga0210384_11110229All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300021474|Ga0210390_10020642All Organisms → cellular organisms → Bacteria → Acidobacteria5360Open in IMG/M
3300021474|Ga0210390_10657243All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300021475|Ga0210392_10189665All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300021478|Ga0210402_10471884All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300021478|Ga0210402_11196159All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300021478|Ga0210402_11809316Not Available537Open in IMG/M
3300024330|Ga0137417_1446702All Organisms → cellular organisms → Bacteria → Acidobacteria2112Open in IMG/M
3300025914|Ga0207671_10555053All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300025915|Ga0207693_10059920All Organisms → cellular organisms → Bacteria → Acidobacteria2982Open in IMG/M
3300026809|Ga0207820_112903All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300026869|Ga0207821_1022420All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300026909|Ga0207858_1012154All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300027502|Ga0209622_1015175All Organisms → cellular organisms → Bacteria1325Open in IMG/M
3300027655|Ga0209388_1002080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4811Open in IMG/M
3300027855|Ga0209693_10486111All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300027869|Ga0209579_10734004Not Available534Open in IMG/M
3300027875|Ga0209283_10461144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300027884|Ga0209275_10693517All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027898|Ga0209067_10129725All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300027908|Ga0209006_11013899All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300028047|Ga0209526_10380937All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300028047|Ga0209526_10532782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300028069|Ga0255358_1054862All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300028759|Ga0302224_10414204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300031573|Ga0310915_11029431Not Available574Open in IMG/M
3300031668|Ga0318542_10542288All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031682|Ga0318560_10055254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1968Open in IMG/M
3300031716|Ga0310813_10984340All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300031718|Ga0307474_10903447All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031720|Ga0307469_11505225All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031740|Ga0307468_101079685All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300031823|Ga0307478_10499587All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300031846|Ga0318512_10210261All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300031846|Ga0318512_10410501All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300031910|Ga0306923_11162448All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031954|Ga0306926_12033262All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300031954|Ga0306926_12120442All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300032001|Ga0306922_10897184All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300032059|Ga0318533_10296684All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300032091|Ga0318577_10262772All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300032174|Ga0307470_10062100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1973Open in IMG/M
3300032180|Ga0307471_102104226All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300032261|Ga0306920_100144608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus3541Open in IMG/M
3300032515|Ga0348332_12077021All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300032895|Ga0335074_10765795All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300033134|Ga0335073_10499014All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300033158|Ga0335077_11819379Not Available571Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil29.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.04%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.36%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.68%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.68%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.84%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.84%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.84%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026809Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes)EnvironmentalOpen in IMG/M
3300026869Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes)EnvironmentalOpen in IMG/M
3300026909Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10373349013300000364SoilIEPETRERVEAAVVAAGGEVLPMKIDRSGVQVTVS*
JGI1027J11758_1263051123300000789SoilCVVLLIEPDARERVEKAVLDAGGELLPMKIDRQGVTVVSQ*
JGI12269J14319_1021166113300001356Peatlands SoilGCIVLLIEPGARERVEKAIVESGGELLPMQIDRQGVTVITQ*
Ga0070731_1106658713300005538Surface SoilIEPEARGRVEKAIRDAGGKILETRIDSQGVQVISR*
Ga0070764_1105765313300005712SoilGCVVMLIEPDARTRVEAAIVEAGGEVLPVTIDRQGVQVISR*
Ga0070766_1042607523300005921SoilEPDARTRVESAIVEAGGEVLPVTIDRQGVQVISR*
Ga0080027_1011483313300005993Prmafrost SoilLIEPDSRGKVEGAVADAGGQVLPMTIDRSGVQVNVS*
Ga0075023_10035684413300006041WatershedsIDPEARGRVETAVAEAGGELLPVRVDRQGVTVVSP*
Ga0075435_10013718913300007076Populus RhizosphereGGGCVVMLIEPGARSGVEKAVSQASGQLLPMKIDRSGVQVTVS*
Ga0099794_1053186023300007265Vadose Zone SoilVVLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS*
Ga0099830_1027660113300009088Vadose Zone SoilIEPEARERVEAAVASAGGQVLPMKIDRSGVQVTVS*
Ga0099830_1047761333300009088Vadose Zone SoilLIEPEARERIQAAVASAGGQVLPMKIDRSGVQVTVS*
Ga0099830_1101236213300009088Vadose Zone SoilVVLLVEPDARERVEMAILEAGAEVLPMTIDRQGVQVVSR*
Ga0099830_1171010523300009088Vadose Zone SoilVLLIEPDARERVEKAIIEAGAQVLPMRIDRQGVQVVSR*
Ga0099828_1053973533300009089Vadose Zone SoilEPEARERVEAAVASAGGQVLPMKIDRSGVQVTVS*
Ga0099828_1075700423300009089Vadose Zone SoilVLLIEPEARERVEAAVASAGGQVLPMKIDRSGVQVTVS*
Ga0099792_1035549013300009143Vadose Zone SoilCVVLLIEPDTRERVEAAVVEAGGEVLPMKLDRSGVQVNVS*
Ga0099792_1071832423300009143Vadose Zone SoilEPDSRDRVQKSFREAGAEVLPMTIDRQGVQVVSR*
Ga0126380_1090159613300010043Tropical Forest SoilLLIEPDAREKVEKAIAAAGGELLPMRIDRSGVQVNVTD*
Ga0126382_1142836123300010047Tropical Forest SoilLIEPEARDRVERAIVDAGGEVLRTTIDRQGVIVISR*
Ga0126373_1010889133300010048Tropical Forest SoilGCVVLLIEPDARDRAEKAVAEAGGEVLHATIDRQGVSVVFR*
Ga0126373_1015408543300010048Tropical Forest SoilCVVLLIEPEARHRVENAIAEAGGEVLHTTIDRRGVSVISR*
Ga0126372_1231755723300010360Tropical Forest SoilCVVLLIEPDARQRVEKAVFDNGGELLPMVIDRQGVTVVTP*
Ga0126379_1295652823300010366Tropical Forest SoilMLIEPDARAGVEKAVADTGGQLLPMKIDRSGVQVIVS*
Ga0126381_10118080823300010376Tropical Forest SoilCVVLLIEPEARERVEKAVLESGGELLPMVIDRQGVTVVTP*
Ga0126383_1058436523300010398Tropical Forest SoilLLIEPQARERVERAVVGCGGELLPMQIDRQGVTVVST*
Ga0137392_1020865913300011269Vadose Zone SoilGGGCVVLLIEPEARERVEAAVTESAGEVLPMKIDRSGVQVIVS*
Ga0137392_1042503133300011269Vadose Zone SoilGGCVVLLIEPEARERVEAAVAAAGGQVLPMKIDRSGVQVTVS*
Ga0137391_1085201923300011270Vadose Zone SoilEPDARDRVETAIRESGAEVLPMTIDRQGVQVVSR*
Ga0137393_1060483613300011271Vadose Zone SoilCVVLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVTVS*
Ga0137389_1034015423300012096Vadose Zone SoilLLIEPEARERVEAAVAAAGGQVLPMKIDRSGVQVTVS*
Ga0137389_1161329313300012096Vadose Zone SoilGGCVVLLIEPDARERVEKAIIEAGAQVLPMRIDRQGVQVVSR*
Ga0137383_1075299223300012199Vadose Zone SoilEPGSRGAVEKAIADAGGQILPMRIDRSGVQVTVS*
Ga0137382_1126815823300012200Vadose Zone SoilLVEPDARERVAKAIREAGAEVLPMTIDRQGVQVVSR*
Ga0137362_1095697213300012205Vadose Zone SoilVVLLIEPDARGNVESAVAQAGGQVLPMRIDRSGVQVNVT*
Ga0137362_1130700613300012205Vadose Zone SoilLIEPETRERVEAAVIEAGGEVLPMKIDRSGVQVTVS*
Ga0137381_1113608013300012207Vadose Zone SoilVVFLIEPEARERVEKAIVEAGAEILPVSIDRQGVQVISR*
Ga0137378_1113682013300012210Vadose Zone SoilVLLIEPGARERVEKAIREAGGEVLPMTIDRHGVQVVSR*
Ga0137384_1121157513300012357Vadose Zone SoilEPDARERVEKAIIEAGAQVLPMRIDRQGVQVVSR*
Ga0137385_1078873823300012359Vadose Zone SoilGGGCVVLLIEPGARERVEKAIREAGGEVLPMTIDRHGVQVVSR*
Ga0137361_1140068823300012362Vadose Zone SoilLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS*
Ga0137390_1007717713300012363Vadose Zone SoilVEPDARERVETAIREAGAEALPMTIDRQGVQVVSR*
Ga0137390_1011624513300012363Vadose Zone SoilEPEARERIQAAVASAGGQVLPMKIDRSGVQVTVS*
Ga0137396_1039403423300012918Vadose Zone SoilLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS*
Ga0137404_1031653733300012929Vadose Zone SoilLLIDPDARESVEKAVAVAGGQLLPMRIDRSGVQVNVTGEW*
Ga0137404_1057122423300012929Vadose Zone SoilEPDARESVEKAVAAAAGELLAMRIDRSGVQVNVT*
Ga0137407_1243548023300012930Vadose Zone SoilLLIEPDARDRVQNSIREAGAEVLPMTIDRQGVQVVSR*
Ga0164302_1094105923300012961SoilVLLIEPDAREKVEAAVAEAGGQLLPMKIDRSGVQVNVS*
Ga0157375_1350006323300013308Miscanthus RhizosphereVVMLIEPDARPSVEKAVANAGGQLLPMKIDRSGVQVTVS*
Ga0181526_1042923213300014200BogVLLIEPDARERVEKAVVEAGGQLLPMHIDRQGVQVVAQ*
Ga0181522_1061179513300014657BogCLVLLIEPDARARVERAVIEAGGQLLPMFLDRQGVTVLTQ*
Ga0157379_1033959223300014968Switchgrass RhizosphereVVLLIEPDAREKVEAAVAEAGGQLLPMKIDRSGVQVNVS*
Ga0137420_116096223300015054Vadose Zone SoilVLLIEPETREKVEAAVVEAGGQVLPMKIDRSGVQVNVS*
Ga0137403_1023748913300015264Vadose Zone SoilVMLIEPDARGRVEMAIEEVGGKVLPMKIDRQGVQVVSR*
Ga0182041_1001507253300016294SoilCVVMLIEPDARPAVEKAVADAGGGLLPMKIDRSGVQVTVS
Ga0182041_1056654523300016294SoilVLIEPDARGSVEKAVSAAGGQLLPMKIDRSGVQVTVS
Ga0187818_1003140433300017823Freshwater SedimentIEPAGRERVEAAIVDAGGQLLPMKIDRSGVRVNVS
Ga0187816_1057512513300017995Freshwater SedimentGCVVLLIEPDARERVEKTVEESGGELLPMQIDRQGVTVVSQ
Ga0187863_1076448423300018034PeatlandLLIEPDARARVEKAVIEVGGQLLPMFLDRQGVTVLTQ
Ga0187887_1004874743300018043PeatlandLLIEPDARARVEAAVAKSGGQLLPMRIDRQGVQVATTP
Ga0187766_1078267313300018058Tropical PeatlandCVVLLIEPEVRERVEKAIEDAGAKVLPVTVDRQGVQVISR
Ga0187769_1057082823300018086Tropical PeatlandGCVVLLIEPDARERVEKAVVESGGELLPVQIDRQGVSVATQ
Ga0187771_1067400413300018088Tropical PeatlandIVLLIEPDARERVEKAVEESGGELLPVQIDRQGVTVVSQ
Ga0187770_1095380813300018090Tropical PeatlandIEPEARERVEKTVVEAGGQLLPMHIDRQGVQVVAQ
Ga0193749_101631613300020010SoilCVVMLIEPGTRGAVEKAVEDAGGQILPMKIDRSGVQVTVF
Ga0210399_1120341213300020581SoilLLIEPDARERVEKAIVEAGGEVLPMTIDRQGVQVVSR
Ga0210395_1098212613300020582SoilVLLIEPDARTRVESSIVESGAEVLPVTIDRQGVQVISR
Ga0210406_1018647013300021168SoilGCVVLLIEPETRERVEAAVVEAGGEVLPMKLDRSGVQVTVS
Ga0210387_1061212023300021405SoilIEPDARTRVEAAIVEAGGEVLPVTIDRQGVQVISR
Ga0210386_1064696223300021406SoilLIDPNARERVESAVTDAGGQLLPMKIDRSGVQVNVS
Ga0210386_1096415813300021406SoilIEPDARDRVEAAVTDAGGQLLPMRIDRSGVQVTVS
Ga0210384_1111022923300021432SoilVLLVEPDARERVETAIQESGGQVLPMTIDRQGVQVVSR
Ga0210390_1002064263300021474SoilMLIEPDARTRVEAAIVEAGGEVLPVTIDRQGVQVISR
Ga0210390_1065724323300021474SoilGCVVLLIEPGARARVERAIGEAGAQVLPVKIDRQGVQVISR
Ga0210392_1018966523300021475SoilGCVVMLIEPDARERVEAAVTDAGGHLLPMRIDRSGVQVTVS
Ga0210402_1047188413300021478SoilGGGCLVLLIEPDARERVEKAVVQCGGELLPMRIDRQGVTVVSQ
Ga0210402_1119615923300021478SoilGGCVVLLIEPDARERVEKAIAEAGGEVLPMTIDRQGVQVVSR
Ga0210402_1180931623300021478SoilGGCVTLLIEPDARTRVEDAVANAGGRLLPFRIDRGGVRVKISR
Ga0137417_144670233300024330Vadose Zone SoilVVLLIEPETRERVEAAVVEAGGEVLPMKIDRSGVQVNVS
Ga0207671_1055505313300025914Corn RhizosphereMLIEPDARDRVEAAVTDAGGHLLPMRIDRSGVQVTVS
Ga0207693_1005992013300025915Corn, Switchgrass And Miscanthus RhizosphereMLIEPGSRGAVEKAIANAGGQVLPMRIDRSGVQVTVS
Ga0207820_11290313300026809Tropical Forest SoilGGCVVLLIEPDARERVEKTIVESGGQLLPMKVDRQGVTVVSQ
Ga0207821_102242013300026869Tropical Forest SoilGGGGCVVLLIEPEARGRVEKAVVDEGGQLLPMFVDRRGVQVVAQ
Ga0207858_101215423300026909Tropical Forest SoilIEPDARERVEKTIVESGGQLLPMKVDRQGVTVVSQ
Ga0209622_101517513300027502Forest SoilVVLLIEPDARERVEKAVVEADGQLLPMHIDRQGVQVVAQ
Ga0209388_100208013300027655Vadose Zone SoilLLIEPDTRERVEAAVVEAGGEVLPMKLDRSGVQVNVS
Ga0209693_1048611123300027855SoilGGGCVVLLIEPDARTRVEAAIVAAGGEVLPVTIDRQGVQVISR
Ga0209579_1073400423300027869Surface SoilIEPEARGRVEKAIRDAGGKILETRIDSQGVQVISR
Ga0209283_1046114413300027875Vadose Zone SoilVALVIEPDARDRVEAAVASAGGRLLPMRIDREGVRVRVAK
Ga0209275_1069351723300027884SoilLIEPDARDRVEKSVVECGGELLPMRIDRQGVTVVSQ
Ga0209067_1012972513300027898WatershedsVVLLIEPDARDRVEKAILEAGGQILPTTIDRQGVQVVSR
Ga0209006_1101389913300027908Forest SoilVLLIDPDARDRVESAVTDAGGQVLPMKIDRSGVQVNVS
Ga0209526_1038093723300028047Forest SoilLLIEHETREKVEAAVAEAGGEVLPMKIDRSGVQVNVS
Ga0209526_1053278213300028047Forest SoilIEPEAREHVEAAVVTAGGQVLPMKIDRSGVQVTVS
Ga0255358_105486213300028069SoilGCVVLLIEPDARERVEKAVAESGGELLPMQIDRQGVTVVTQ
Ga0302224_1041420413300028759PalsaEPDARGRVETAIAKAGGQLLPLRIDRQGVQVTSTP
Ga0310915_1102943123300031573SoilGCLVLVIEPGVRERVEKAVLDCGGELLPMHIDRQGVTVVSS
Ga0318542_1054228813300031668SoilLLIEPDARPRVEKAILDSGGELLPMQIDRQGVTVVSQ
Ga0318560_1005525433300031682SoilVLLIEPDARDRAEKAVSEAGGDVLRAAIDRQGVSVVFR
Ga0310813_1098434013300031716SoilLIEPDARSSVESAIVAAGGEVLPVRIDRQGVQVISR
Ga0307474_1090344713300031718Hardwood Forest SoilLLVEPEARERVEAAVVEAGGDVLPMKIDRSGVQVTVS
Ga0307469_1150522513300031720Hardwood Forest SoilCVVLLIEPDARERVEAAVLEAGGEVLPMKIDRSGVQVNVS
Ga0307468_10107968513300031740Hardwood Forest SoilLLIEPDARPRVEKAVVDCGGELLPMRIDRQGVTVVSQ
Ga0307478_1049958713300031823Hardwood Forest SoilVLLIEPDARSRVETAIAEAGGEVLPVTIDRQGVQVISR
Ga0318512_1021026123300031846SoilLIEPDARERVEKTVLESGGQLLPMRVDRQGVTVVSQ
Ga0318512_1041050123300031846SoilVLLIEPDARERVEKTIVESGGQLLPMKVDRQGVTVVSQ
Ga0306923_1116244813300031910SoilVVLLIEPDARERVEKTVLESGGQLLPMRVDRQGVTVVSQ
Ga0306926_1203326213300031954SoilVVLLIEPDARERVEKAVLDAGGELLPMRIDRQGVTVVSQ
Ga0306926_1212044223300031954SoilGGGCVVLLIEQDARERVEKTVLESGGQLLPMRVDRQGVTVVSQ
Ga0306922_1089718423300032001SoilLLIEPDARERVEKAVLDAGGELLPMRIDRQGVTVVSQ
Ga0318533_1029668413300032059SoilIEPDARGSVEQAVANAGGQLLPMKIDRSGVQVTVS
Ga0318577_1026277213300032091SoilCVVLLIEPDARDRAEKAVTDAGGEVLRAAIDRQGVSVVFR
Ga0307470_1006210043300032174Hardwood Forest SoilCLVLLIEPDARERVENSVAECGGELLPMRIDRQGVTVVSQ
Ga0307471_10210422623300032180Hardwood Forest SoilCVVLLIEPDARERVEKAVVESGGELLPMRIDRQGVTVVSQ
Ga0306920_10014460823300032261SoilVVLLIDPETRGRVEKAIVEAGGQLLPMYIDRQGVKVVAQ
Ga0348332_1207702123300032515Plant LitterGCVVLLIEPDARTRVEASIVEAGAEVLPVTIDRQGVQVISR
Ga0335074_1076579523300032895SoilGGCVVLLIEPDARTSVEAAIVETGAEVLPVTVDRQGVQVISR
Ga0335073_1049901413300033134SoilVLLIEPDARERVEKAVVEAGGQLLPMHIDRQGVHVVAQ
Ga0335077_1181937913300033158SoilLLIEPDARAAVERAVVAGGGRVLPVRLDRRGVTVRVSR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.