NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074627

Metagenome Family F074627

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074627
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 46 residues
Representative Sequence EQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPEDPLAPRR
Number of Associated Samples 100
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.68 %
% of genes near scaffold ends (potentially truncated) 95.80 %
% of genes from short scaffolds (< 2000 bps) 91.60 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.513 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(26.891 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.176 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.74%    β-sheet: 0.00%    Coil/Unstructured: 80.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF02781G6PD_C 10.92
PF01878EVE 8.40
PF00378ECH_1 4.20
PF01594AI-2E_transport 4.20
PF01979Amidohydro_1 3.36
PF00892EamA 3.36
PF00528BPD_transp_1 3.36
PF00072Response_reg 1.68
PF04392ABC_sub_bind 1.68
PF00293NUDIX 1.68
PF01243Putative_PNPOx 1.68
PF02720DUF222 1.68
PF03150CCP_MauG 1.68
PF00005ABC_tran 1.68
PF04909Amidohydro_2 1.68
PF00753Lactamase_B 1.68
PF01425Amidase 1.68
PF028262-Hacid_dh_C 0.84
PF03992ABM 0.84
PF03447NAD_binding_3 0.84
PF07969Amidohydro_3 0.84
PF00939Na_sulph_symp 0.84
PF12852Cupin_6 0.84
PF00480ROK 0.84
PF01610DDE_Tnp_ISL3 0.84
PF05544Pro_racemase 0.84
PF00881Nitroreductase 0.84
PF07732Cu-oxidase_3 0.84
PF12833HTH_18 0.84
PF02515CoA_transf_3 0.84
PF07685GATase_3 0.84
PF00106adh_short 0.84
PF02627CMD 0.84
PF13458Peripla_BP_6 0.84
PF13561adh_short_C2 0.84
PF07228SpoIIE 0.84
PF04542Sigma70_r2 0.84
PF01738DLH 0.84
PF15919HicB_lk_antitox 0.84
PF07992Pyr_redox_2 0.84
PF14319Zn_Tnp_IS91 0.84
PF13302Acetyltransf_3 0.84
PF13466STAS_2 0.84
PF04187Cofac_haem_bdg 0.84
PF02954HTH_8 0.84
PF01717Meth_synt_2 0.84
PF01315Ald_Xan_dh_C 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 10.92
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 8.40
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 8.40
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 4.20
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.68
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 1.68
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.68
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.68
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.84
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.84
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.84
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.84
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.84
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.84
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.84
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.84
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.84
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.84
COG3016Putative heme-binding protein PhuWGeneral function prediction only [R] 0.84
COG3464TransposaseMobilome: prophages, transposons [X] 0.84
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.84
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.51 %
UnclassifiedrootN/A18.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01A0PMVAll Organisms → cellular organisms → Bacteria591Open in IMG/M
3300004114|Ga0062593_100875095All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300004157|Ga0062590_100248912All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1336Open in IMG/M
3300004633|Ga0066395_10761482All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005174|Ga0066680_10429765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus836Open in IMG/M
3300005175|Ga0066673_10020610All Organisms → cellular organisms → Bacteria3028Open in IMG/M
3300005179|Ga0066684_10312208All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1046Open in IMG/M
3300005181|Ga0066678_10527895All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium784Open in IMG/M
3300005186|Ga0066676_10145547All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300005186|Ga0066676_10342726All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300005295|Ga0065707_10299667All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300005330|Ga0070690_101665959All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005332|Ga0066388_100051160All Organisms → cellular organisms → Bacteria4245Open in IMG/M
3300005332|Ga0066388_100939469All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300005332|Ga0066388_102905898All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300005332|Ga0066388_103801853All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005332|Ga0066388_106940738All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005332|Ga0066388_107622991Not Available543Open in IMG/M
3300005353|Ga0070669_100466636All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300005441|Ga0070700_100070684All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300005444|Ga0070694_101151402All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005450|Ga0066682_10097485All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300005454|Ga0066687_10391513All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005540|Ga0066697_10390285All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium809Open in IMG/M
3300005543|Ga0070672_100381778All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300005546|Ga0070696_100843976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300005549|Ga0070704_100555856All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1003Open in IMG/M
3300005552|Ga0066701_10692187All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005553|Ga0066695_10436636All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005555|Ga0066692_10106247All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300005555|Ga0066692_10548526All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005713|Ga0066905_100360001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1166Open in IMG/M
3300005840|Ga0068870_10135033All Organisms → cellular organisms → Bacteria → Proteobacteria1437Open in IMG/M
3300006049|Ga0075417_10420147All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300006796|Ga0066665_10934485All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006844|Ga0075428_102336555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium550Open in IMG/M
3300006845|Ga0075421_100601758All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300006847|Ga0075431_100517486Not Available1183Open in IMG/M
3300006847|Ga0075431_101845090All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006852|Ga0075433_10881647All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300006853|Ga0075420_100383281All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300006854|Ga0075425_100223444All Organisms → cellular organisms → Bacteria2166Open in IMG/M
3300006871|Ga0075434_100924939All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300006871|Ga0075434_102410137Not Available528Open in IMG/M
3300006903|Ga0075426_10235781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae1331Open in IMG/M
3300009038|Ga0099829_10285794All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300009090|Ga0099827_10603377All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300009090|Ga0099827_11573864All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009090|Ga0099827_11596027All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300009094|Ga0111539_12170258Not Available644Open in IMG/M
3300009094|Ga0111539_13336483All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300009137|Ga0066709_100035921All Organisms → cellular organisms → Bacteria5355Open in IMG/M
3300009147|Ga0114129_10880093All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300009147|Ga0114129_12217862All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009553|Ga0105249_11039124All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria889Open in IMG/M
3300009792|Ga0126374_11157256All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300010320|Ga0134109_10408887All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300010360|Ga0126372_10888471All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300010376|Ga0126381_100115845All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3457Open in IMG/M
3300010398|Ga0126383_10702421Not Available1090Open in IMG/M
3300010399|Ga0134127_11541316All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300010401|Ga0134121_12955150Not Available522Open in IMG/M
3300011269|Ga0137392_10901329Not Available728Open in IMG/M
3300012201|Ga0137365_10350342Not Available1091Open in IMG/M
3300012205|Ga0137362_10388143All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300012357|Ga0137384_10581620All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium915Open in IMG/M
3300012532|Ga0137373_10802551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium695Open in IMG/M
3300012685|Ga0137397_10092980All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300012918|Ga0137396_10340462All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1110Open in IMG/M
3300012929|Ga0137404_10294918All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300012929|Ga0137404_11606511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium603Open in IMG/M
3300012975|Ga0134110_10173367All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria897Open in IMG/M
3300012977|Ga0134087_10240390All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium826Open in IMG/M
3300013306|Ga0163162_10794132All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300013307|Ga0157372_12365227All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300014269|Ga0075302_1143071All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300015357|Ga0134072_10387699All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300015373|Ga0132257_104318729Not Available517Open in IMG/M
3300016341|Ga0182035_11640859Not Available580Open in IMG/M
3300017659|Ga0134083_10035989All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300017789|Ga0136617_10713921Not Available777Open in IMG/M
3300018027|Ga0184605_10021097All Organisms → cellular organisms → Bacteria → Proteobacteria2612Open in IMG/M
3300018031|Ga0184634_10219177All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300018056|Ga0184623_10013022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae3613Open in IMG/M
3300019883|Ga0193725_1001995All Organisms → cellular organisms → Bacteria5908Open in IMG/M
3300025908|Ga0207643_10104325All Organisms → cellular organisms → Bacteria1665Open in IMG/M
3300025911|Ga0207654_10136806All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300025917|Ga0207660_10237335All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300025934|Ga0207686_11384284Not Available579Open in IMG/M
3300026088|Ga0207641_12531567All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300026320|Ga0209131_1404863Not Available511Open in IMG/M
3300026332|Ga0209803_1339453All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300026334|Ga0209377_1106514All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300026358|Ga0257166_1062950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium536Open in IMG/M
3300027846|Ga0209180_10247601All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300027882|Ga0209590_11066003All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300028380|Ga0268265_12620798Not Available510Open in IMG/M
3300028784|Ga0307282_10628191Not Available521Open in IMG/M
3300031184|Ga0307499_10158406Not Available669Open in IMG/M
(restricted) 3300031197|Ga0255310_10179943All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria587Open in IMG/M
3300031546|Ga0318538_10518721All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031681|Ga0318572_10212187All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300031720|Ga0307469_10214670All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300031720|Ga0307469_11952816Not Available569Open in IMG/M
3300031731|Ga0307405_10483127All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300031740|Ga0307468_101011219All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300031740|Ga0307468_101075938All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031740|Ga0307468_101446356All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031771|Ga0318546_11123612Not Available552Open in IMG/M
3300031846|Ga0318512_10086997All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300031912|Ga0306921_11693890All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium684Open in IMG/M
3300031947|Ga0310909_10784577Not Available788Open in IMG/M
3300032066|Ga0318514_10507107All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300032066|Ga0318514_10588117All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300032075|Ga0310890_10276384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1196Open in IMG/M
3300032174|Ga0307470_10328928Not Available1050Open in IMG/M
3300032180|Ga0307471_102725987All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300032180|Ga0307471_103971450Not Available523Open in IMG/M
3300033550|Ga0247829_10455190Not Available1057Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.68%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_050070802170459017Switchgrass, Maize And Mischanthus LitterTRRQAFDDLVRWVEYGVRPDGEDVLAPDLSRIGLKWTPYLDPEDPLAPRR
Ga0062593_10087509523300004114SoilTQQQAFDDLVAWIERGAKPVGEDVLAPDLSRIGLKWTPHLLLEDPLAPRR*
Ga0062590_10024891213300004157SoilQAFDDLVAWIERGVRPDGEDVLAPDLSRVGLKWTPYLHPEDPLAERR*
Ga0066395_1076148213300004633Tropical Forest SoilREQAFDDLVAWIERGVKPDGDDVLTADPSKLELRWTSILHHDDPARRR*
Ga0066680_1042976513300005174SoilEQAFDDLVAWVERGVRPVGEDVLAADLSRVGLKWTPNLHPEDPLALRR*
Ga0066673_1002061013300005175SoilREQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPEDPLAPRR*
Ga0066684_1031220823300005179SoilLLAWIERGVRPVGEDVLAPDLSRIGLKWTPTLQPEDPLALRR*
Ga0066678_1052789513300005181SoilDLVAWIERGVRPQGEDVLATDLSRIGLKWTLILHPQDPLAPRR*
Ga0066676_1014554733300005186SoilVREQAFDDLVAWVEGGARPDGDDVLAADISTLGLRWTSILHPEDPARRRTLPAR*
Ga0066676_1034272613300005186SoilREQAFDDLVAWMEKGIKPDGDDVLAPDVSTLGLRWTPLHHPEDPMQRR*
Ga0065707_1029966713300005295Switchgrass RhizosphereRRQAFDDLVRWIEHGVRPDGEDVLAPDLSRIGLKWTPYLDPEDPLARRP*
Ga0070690_10166595923300005330Switchgrass RhizosphereFDDLVAWIERGVRPQGEDVLAPDLSRIGLTWTPILHLEDPLAARR*
Ga0066388_10005116043300005332Tropical Forest SoilVRERAFDDLVGWIERAGVPPGDDVLASDVSTLGLRWTPALHPADPLAPRTR*
Ga0066388_10093946913300005332Tropical Forest SoilTREQAFDDLVAWMERGIKPTGDDVLATDMSTLGLRWTPVLHVEDPARGRKSSHK*
Ga0066388_10290589823300005332Tropical Forest SoilFYAETRERTFDDLVAWVERGVKPQGEDVLARDLSGIGMKWTPILLADDPLFVKR*
Ga0066388_10380185323300005332Tropical Forest SoilFDDLVAWMERGIKPTGDDVLATDMSTLGLRWTPVLHVEDPARGRESSHK*
Ga0066388_10694073813300005332Tropical Forest SoilMREQAFDDLVAWIERGVRPAGEDVLAADLSRIGLPWTPALHPEDPLALRR*
Ga0066388_10762299113300005332Tropical Forest SoilAWIERGVRPKGEDILAPDLSRIGLEWTPALLLDDPLAATRKTP*
Ga0070669_10046663613300005353Switchgrass RhizosphereAFDDLVAWIERGVRPDGDDVLAPDLSRIGLKWTPHLLLEDPLAPRR*
Ga0070700_10007068413300005441Corn, Switchgrass And Miscanthus RhizosphereRQAFDDLVAWIERRIRPDGEDLLAADLSRIGLKWTPHLHPEDPLAASR*
Ga0070694_10115140223300005444Corn, Switchgrass And Miscanthus RhizosphereAFDDLVAWIERGIRPDGEDVLAADLSRVGLKWTPYLHLEDPLAASR*
Ga0066682_1009748513300005450SoilREQAFDDLVAWVEGGARPDGDDVLAPDVSTLGLGRTPILHPEDPARRRTLPAR*
Ga0066687_1039151323300005454SoilGETREQAFDDLLAWIERGVRPVGEDVLAPDLSLIGLKWTPTLQPEDPLALRR*
Ga0066697_1039028523300005540SoilLVAWIERGVRPQGEDVLATDLSRIGLKWTPILHPTDPLAARR*
Ga0070672_10038177813300005543Miscanthus RhizosphereAFDDLVAWIERGVRPRGEDVLAPDLSRIGLTWTPILHLEDPLAVRR*
Ga0070696_10084397623300005546Corn, Switchgrass And Miscanthus RhizosphereAFEDLVAWIERGVVPAGDDVLAADVSRLGLRWTPALHPADPLAGSAR*
Ga0070704_10055585613300005549Corn, Switchgrass And Miscanthus RhizosphereFDDLVAWIERGVRPQGEDVLARDLSRLGLTWTPILHPEDPLAPRR*
Ga0066701_1069218723300005552SoilREQAFDDLVAWVEGGARPDGDDVLAADMSTLGLRRTSILHPEDPARRRTLPAR*
Ga0066695_1043663613300005553SoilQAFDDLVAWIEHGVQPAGDDVLADDVSKLGLRWIPILHPDDPARRP*
Ga0066692_1010624733300005555SoilERGVRPVGEDVLAPDLSRIGLRWTPSLHPEDPLALRR*
Ga0066692_1054852613300005555SoilQAFDDLVAWIEREKPEGDDVLAADVSTLGLRWTSILHSEDPARRREPPGGDGARAAA*
Ga0066905_10036000133300005713Tropical Forest SoilAWIERGVRPAGEDVLAADLSRIGLKWTTILHPEDPLAARR*
Ga0068870_1013503333300005840Miscanthus RhizosphereRGIRPDGEDLLAADLSRIGLKWTPHLHPEDPLAASR*
Ga0075417_1042014713300006049Populus RhizosphereMREQAFDDLVAWIERGARPVGEDVLAPDLSRIGLSWTPALHPEDPLALRR*
Ga0066665_1093448513300006796SoilREQAFDDLVAWIERGVRPVGEDVLARDLSRIGLRWTMSLHPEDPLALRR*
Ga0075428_10233655523300006844Populus RhizosphereERGAKPEGEDVLAPDLSRIGLKWTPYLHTEDPLNPRR*
Ga0075421_10060175823300006845Populus RhizosphereERGVRPTGEDVLAADLSRIGMPWTRVLLPDDPLAPRR*
Ga0075431_10051748613300006847Populus RhizosphereWMERGVRPAGEDVLAADLSRIGLKWTPSLYPEDPLALRR*
Ga0075431_10184509013300006847Populus RhizosphereRWIEQGARPAGDDVLARDLSRVGLRWTSIMYPDDPLFPRR*
Ga0075433_1088164733300006852Populus RhizosphereREQAFDDLVRWIEGGSQPDGDDVLASDVSQIGLRWTPLLHVEDPLRQ*
Ga0075420_10038328113300006853Populus RhizosphereVAWIERGVKPEGEDVLAPDLSRIGLKWTPMLHVDDPLAPTR*
Ga0075425_10022344433300006854Populus RhizosphereDGVTLRQTFDDLVAWVERGVKPDGEDVLAPDLTRIGLKWTPYLLLDDPLGPRR*
Ga0075434_10092493913300006871Populus RhizosphereEQAFDDLVAWIEKGTKPDGDDVLAPDVSTLGLRWTHIRHPEDPELRRKPARN*
Ga0075434_10241013723300006871Populus RhizosphereDDLVAWMERGVRPQGEDVLATDLSRIGLKWTPILHPEDPLAARR*
Ga0075426_1023578143300006903Populus RhizosphereAFEDLVAWIERGVVPAGDDVLAPDVSRLGLRWTPALHPADPLAPATR*
Ga0099829_1028579433300009038Vadose Zone SoilEQAFDDLVAWMERGVKPEGEDLLASDLSRVGMKWTPVLHPEDPLAPKR*
Ga0099827_1060337713300009090Vadose Zone SoilGETREQAFDDLVAWIERGVRRAGEDVLAPDLSRIGLNWTPALRVEDPLITRW*
Ga0099827_1157386413300009090Vadose Zone SoilGVKPEGEDLLASDLSRVGMKWTPVLHPEDPLAPKR*
Ga0099827_1159602723300009090Vadose Zone SoilGVRPAGEDMLAPDLSRIGLKWTPTLHLEDPLTTRR*
Ga0111539_1217025813300009094Populus RhizosphereARPEGEDVLANDLSRIGLKWTPILHVDDPLAGRR*
Ga0111539_1333648313300009094Populus RhizosphereAFDDLVAWIERGVRPPGEDVLAPDLSRIGLPWTPVLHLEDPLALRR*
Ga0066709_10003592173300009137Grasslands SoilERGVRPEGEDVLARDLSRIGLKWTRTLYPEDPLFRRQ*
Ga0114129_1088009313300009147Populus RhizosphereTREQAFDDLVAWIERGVRPAGEDVLAPDLSRIGLKWTPILHPEDPLAARR*
Ga0114129_1221786223300009147Populus RhizosphereVAWIERGARPDGEDVLARDLSRIGLKWTPVLLLEDPLAAPR*
Ga0105249_1103912413300009553Switchgrass RhizosphereDGDTRRQAFDDLVAWVERGVRPQGEDVLAPDLSRIGMAWTRALHLDDPLFTRPGAGSSSAPR*
Ga0126374_1115725623300009792Tropical Forest SoilEQAFDDLVAWMEQGIKPTGDDVLATDMSTLGLRWTPVLHVEDPARGRESSHK*
Ga0134109_1040888713300010320Grasslands SoilEQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPEDPLAPRR*
Ga0126372_1088847133300010360Tropical Forest SoilVEHGVRPDGEDVLAPDLSRIGLKWTPYLDPGDPLAPRR*
Ga0126381_10011584553300010376Tropical Forest SoilETREQAFDDLVAWMERGIKPTGDDVLATDMSTLGLRWTPVLHAEDPARGRESSPK*
Ga0126383_1070242123300010398Tropical Forest SoilFDDLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLEDPLFQRR*
Ga0134127_1154131613300010399Terrestrial SoilQAFDDLVAWIERGIRPDGEDLLAADLSRIGLKWTPYLHPDDPLAARR*
Ga0134121_1295515023300010401Terrestrial SoilVVRGPGHCATDGVTLRQTFDDLVAWVERGVKPDGEDVLAPDLTRIGLKWTPYLLLDDPLAPRR*
Ga0137392_1090132923300011269Vadose Zone SoilEVREQAFDDLVRWIEGGAQPDGDDVLASDVSQIGLRWTPLLHVEDPLRQ*
Ga0137365_1035034213300012201Vadose Zone SoilERGVRPAGDDVLAADLSRVGLTWTPILYPGDPLAPRR*
Ga0137362_1038814313300012205Vadose Zone SoilIDRGVRPDGEDVLASDLSRVGLKWTPYLHPEDPLAARR*
Ga0137384_1058162023300012357Vadose Zone SoilVREQAFDDLVAWVEGGARPDGDDVLAADVSTLGLLRTSILHPEDPARRRTAPAR*
Ga0137373_1080255113300012532Vadose Zone SoilVREQAFDDLVAWVEGGARPDGDDVLAADVSTLGLRRTSILHPEDPARRRTAPAR*
Ga0137397_1009298033300012685Vadose Zone SoilLVAWIERGVRPQGEDVLARDLSRIGLAWPLALDPDDPLAGKPR*
Ga0137396_1034046223300012918Vadose Zone SoilVRPAGEDVLARDLSRIGLAWTLALHPDDPLAGQRR*
Ga0137404_1029491813300012929Vadose Zone SoilTTRQQAFDDLVGWIERGIRPQGEDVLAPDLSRIGLKWTPILHLEDPLAVRR*
Ga0137404_1160651113300012929Vadose Zone SoilMREQAFDDLVAWMEKGIKPDGDDVLAPDVSTLGLRWTPLRHPEDPVQRREPSRQ*
Ga0134110_1017336713300012975Grasslands SoilREQAFDDLLAWIERGVRPVGEDVLAPDLSRIGLKWTPNLQPEDPLALRR*
Ga0134087_1024039013300012977Grasslands SoilDLLAWIERGVRPVGEDVLAPDLSRIGLKWTPTLQPEDPLALRR*
Ga0163162_1079413213300013306Switchgrass RhizosphereLVAWIERGVRPVGEDVLAPDLSRIGLAYTPALFLEDPLAPRR*
Ga0157372_1236522723300013307Corn RhizosphereRWVEHGVRPDGEDVLAPDLSRIGLKWTPYLDPEDPLAPRR*
Ga0075302_114307123300014269Natural And Restored WetlandsDLVAWIERGVRPQGEDVLAPDQSRIGLQWTPILFPEDPLAARRPR*
Ga0134072_1038769913300015357Grasslands SoilTREQAFDDLVAWIERGVRPDGEDVLASDLSRIGLKWTPVLHPDDPLAPRR*
Ga0132257_10431872913300015373Arabidopsis RhizosphereKGEDVLAPDLSRIGLEWTPALMLDDPLAATRKAP*
Ga0182035_1164085923300016341SoilGSHCGFDGEMREQAFDDIVAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR
Ga0134083_1003598913300017659Grasslands SoilVREQAFDDLVAWVEGGARPDGDDVLAPDVSPLGLRRTPIIHPEDPARRRTPPKR
Ga0136617_1071392123300017789Polar Desert SandFDDLVAWMERGIVPEGDDVLASDLTTLGLLWTTPLLPEDPAGQ
Ga0184605_1002109713300018027Groundwater SedimentGFDGKTREQAFDDLVGWIEGGVRPVGEDVLAPNLSRIGLKWTPVLHLEDPLAARR
Ga0184634_1021917723300018031Groundwater SedimentDGKTREQAFDDLDAWIERGVRPQGEDVLAPDLSRIGLRWTPVLHLEDPLAARR
Ga0184623_1001302263300018056Groundwater SedimentGVRSQGEDVLAPDLSRIGLTWTPILHLEDPLAVRR
Ga0193725_1001995113300019883SoilDDLVAWIERGVRPQGEDVLAPDLSRIGLKWTPALHPEDPLAPRRSSSRP
Ga0207643_1010432543300025908Miscanthus RhizosphereERGIRPDGEDLLAADLSRIGLKWTPHLHPEDPLAASR
Ga0207654_1013680613300025911Corn RhizosphereAFDDLVVWIERGVRPKGEDVLAPDLSRIGLEWTPALMLDDPLAATRKAP
Ga0207660_1023733523300025917Corn RhizosphereERGVRPRGEDVLAPDLSRIGLTWTPILHLEDPLAARR
Ga0207686_1138428423300025934Miscanthus RhizosphereVRPKGEDVLAPDLSRVGLEWTPTLLLDDPLAATRKKP
Ga0207641_1253156723300026088Switchgrass RhizosphereDDLVAWVERGVKPDGEDVLAPDLTRIGLKWTPYLLLDDPLAPRR
Ga0209131_140486323300026320Grasslands SoilAFDDLVGWIERGIRPQGEDVLAPDLSRIGLKWTPILHLEDPLAVRR
Ga0209803_133945313300026332SoilGETREQAFDDLLAWIERGVRPVGEDVLAPDLSRIGLKWTPNLQPEDPLALRR
Ga0209377_110651423300026334SoilRGVRPVGEDVLAPDLSRIGLRWTPSLHPEDPLALRR
Ga0257166_106295023300026358SoilERGVKPEGEDLLASDLSRVGMKWTPVLHPEDPLAPKR
Ga0209180_1024760123300027846Vadose Zone SoilQAFDDLVAWIERGVRPAGEDVLAPDLSRIGLKWTPALHLEDPLTTRR
Ga0209590_1106600313300027882Vadose Zone SoilGETREQAFDDLVAWIERGVRRAGEDVLAPDLSRIGLNWTPALRVEDPLIMRR
Ga0268265_1262079823300028380Switchgrass RhizosphereLVAWIERGVRPQGDDVLASDLSRIGMKWTPVLDADDPLAPRR
Ga0307282_1062819123300028784SoilVDRGTRTQAFDDLVAWIERGVRPDGEDLLATDLSRIGLKWTPYLHPEDPLAARR
Ga0307499_1015840613300031184SoilQTQQQAFDDLVAWIERGAKPVGEDVLAPDLSRIGLKWTPHLLLEDPLAPRR
(restricted) Ga0255310_1017994313300031197Sandy SoilREQAFDDLVAWIERGVRPDGEDVLANDLTRIGLRWTPVFHVEDPLAPRR
Ga0318538_1051872113300031546SoilAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR
Ga0318572_1021218723300031681SoilEQAFDDLVAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR
Ga0307469_1021467033300031720Hardwood Forest SoilGETRERAFDDLVAWIERGMRPDGDDVLARDLSRVGLKWTRTLYPEDPLFRRP
Ga0307469_1195281613300031720Hardwood Forest SoilGHCAFDGATIAQAFDDLIAWIERGVRPVGEDVLAPDLSRIGLKWTPHLLLEDPLAPRR
Ga0307405_1048312723300031731RhizosphereVDGVTRRQAFDDLVAWIERGVQPAGEDVLAHDLSRVGLQWTPLLHPEDPLARKP
Ga0307468_10101121923300031740Hardwood Forest SoilGSTRRQAFDDLVAWIERGVRPDGEDVLAPDLSRVGLKWTPYLHLEDPLAARR
Ga0307468_10107593813300031740Hardwood Forest SoilDDLVAWMERGVRPAGEDVLAADLSRVGLKWTLSLHPEDPLALRR
Ga0307468_10144635623300031740Hardwood Forest SoilDLVAWIERGTRPVGEDVLAPDLSRIGLGWTLSLHPEDPLALRR
Ga0318546_1112361213300031771SoilAVQAQAFDDLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLDDPLFQRR
Ga0318512_1008699733300031846SoilDDLVAWVERGVRPVGEDVLASDLSRVGVRWTRYLLPNDPLFPRR
Ga0306921_1169389023300031912SoilGVKPAGEDVLATDLSRIGLKWTPVLDLDDPLAPRR
Ga0310909_1078457723300031947SoilAQAFDDLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLDDPLFQRR
Ga0318514_1050710723300032066SoilLVAWIERGVKPAGEDVLAPDLSRIGLKYTPQLLLDDPLFQRR
Ga0318514_1058811713300032066SoilAWIERGVKPAGEDVLATDLSRIGLKWTPVLDLDDPLAPRR
Ga0310890_1027638423300032075SoilRRSFDDLVAWIERGARPDGEDVLARDLSRIGLKWTPVLLLEDPLAAPR
Ga0307470_1032892823300032174Hardwood Forest SoilGVRPQGDDVLASDLSRIGMRWTPVLDPDDPLAPRR
Ga0307471_10272598723300032180Hardwood Forest SoilAWMERGEKPEGEDLLASDLSRVGMKWTPILDPEDPLAPKR
Ga0307471_10397145013300032180Hardwood Forest SoilDLVAWIERGVRPQGDDVLASDLSRIGMKWTPVLDVDDPLAPRR
Ga0247829_1045519013300033550SoilAFDDLVAWIERGVRPDGEDVLAADLSRVGLKWTPYLHPEDPLAARR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.