NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074628

Metagenome / Metatranscriptome Family F074628

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074628
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 44 residues
Representative Sequence WYGIWALKKLGLARQVYRVKLSELDRKEEAKAAAPARELVSV
Number of Associated Samples 108
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.61 %
% of genes near scaffold ends (potentially truncated) 92.44 %
% of genes from short scaffolds (< 2000 bps) 89.92 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.034 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.126 % of family members)
Environment Ontology (ENVO) Unclassified
(25.210 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.261 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.29%    β-sheet: 0.00%    Coil/Unstructured: 55.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00512HisKA 31.09
PF02518HATPase_c 26.89
PF00072Response_reg 2.52
PF00487FA_desaturase 2.52
PF02517Rce1-like 1.68
PF09364XFP_N 0.84
PF00486Trans_reg_C 0.84
PF00171Aldedh 0.84
PF05362Lon_C 0.84
PF00005ABC_tran 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 2.52
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 2.52
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 1.68
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 1.68
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.84
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.84
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.84
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.84
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.84
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.84
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.03 %
UnclassifiedrootN/A15.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10763740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae629Open in IMG/M
3300005167|Ga0066672_10643963All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005174|Ga0066680_10314261All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300005329|Ga0070683_100685882All Organisms → cellular organisms → Bacteria → Acidobacteria981Open in IMG/M
3300005343|Ga0070687_100051412Not Available2133Open in IMG/M
3300005435|Ga0070714_100604732All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300005436|Ga0070713_101402434All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005445|Ga0070708_101212981All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005454|Ga0066687_10795170All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005467|Ga0070706_101393106All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005538|Ga0070731_10254541All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300005545|Ga0070695_100878197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae723Open in IMG/M
3300005576|Ga0066708_10784016All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005718|Ga0068866_10198756All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300005841|Ga0068863_101346234All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300005952|Ga0080026_10155647All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300006102|Ga0075015_100781263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae572Open in IMG/M
3300006796|Ga0066665_10922635All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300006806|Ga0079220_10276529All Organisms → cellular organisms → Bacteria → Acidobacteria1022Open in IMG/M
3300006806|Ga0079220_12122539Not Available503Open in IMG/M
3300006954|Ga0079219_11769195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009038|Ga0099829_10054280All Organisms → cellular organisms → Bacteria → Acidobacteria2980Open in IMG/M
3300009093|Ga0105240_10032356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 836772Open in IMG/M
3300009137|Ga0066709_104274142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300009521|Ga0116222_1208081All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300009522|Ga0116218_1142842All Organisms → cellular organisms → Bacteria → Acidobacteria1087Open in IMG/M
3300009665|Ga0116135_1033196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1774Open in IMG/M
3300009700|Ga0116217_10672641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300009839|Ga0116223_10907886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4502Open in IMG/M
3300010048|Ga0126373_12845240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300010339|Ga0074046_10827696All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010359|Ga0126376_11523090All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300010371|Ga0134125_10502315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1343Open in IMG/M
3300010396|Ga0134126_11126112All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300010400|Ga0134122_11280608All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300011089|Ga0138573_1323091All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300011120|Ga0150983_12185240Not Available687Open in IMG/M
3300011270|Ga0137391_11461432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012199|Ga0137383_10616956All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300012199|Ga0137383_10919023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300012202|Ga0137363_11325247Not Available609Open in IMG/M
3300012205|Ga0137362_10938123All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300012349|Ga0137387_10637989All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300012362|Ga0137361_11003140All Organisms → cellular organisms → Bacteria → Acidobacteria754Open in IMG/M
3300012917|Ga0137395_10400848All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300012917|Ga0137395_11107678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300012918|Ga0137396_10572390All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300012930|Ga0137407_10933794All Organisms → cellular organisms → Bacteria → Acidobacteria821Open in IMG/M
3300013104|Ga0157370_10603920All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300013306|Ga0163162_12039389All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300014166|Ga0134079_10653352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300014325|Ga0163163_10230160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1902Open in IMG/M
3300014489|Ga0182018_10485654Not Available654Open in IMG/M
3300014495|Ga0182015_10074677All Organisms → cellular organisms → Bacteria2396Open in IMG/M
3300014838|Ga0182030_10259809All Organisms → cellular organisms → Bacteria1972Open in IMG/M
3300015053|Ga0137405_1420131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1052Open in IMG/M
3300015087|Ga0167637_1033859All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300015374|Ga0132255_104581716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4586Open in IMG/M
3300017995|Ga0187816_10073098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1455Open in IMG/M
3300018007|Ga0187805_10524177Not Available556Open in IMG/M
3300018022|Ga0187864_10260858All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300018033|Ga0187867_10065606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2152Open in IMG/M
3300018482|Ga0066669_10861495All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300020579|Ga0210407_11293332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4545Open in IMG/M
3300020580|Ga0210403_10919017All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300020581|Ga0210399_10984288Not Available680Open in IMG/M
3300020582|Ga0210395_10358344All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300020582|Ga0210395_11340823Not Available523Open in IMG/M
3300021088|Ga0210404_10075872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1644Open in IMG/M
3300021088|Ga0210404_10886260Not Available510Open in IMG/M
3300021178|Ga0210408_10285338All Organisms → cellular organisms → Bacteria → Acidobacteria1316Open in IMG/M
3300021407|Ga0210383_11261451Not Available619Open in IMG/M
3300021420|Ga0210394_10166251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1919Open in IMG/M
3300021432|Ga0210384_11392770Not Available606Open in IMG/M
3300021478|Ga0210402_10324275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1427Open in IMG/M
3300021478|Ga0210402_10909083All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300021559|Ga0210409_10698232All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300024271|Ga0224564_1024018All Organisms → cellular organisms → Bacteria → Acidobacteria1120Open in IMG/M
3300025898|Ga0207692_10247254All Organisms → cellular organisms → Bacteria → Acidobacteria1067Open in IMG/M
3300025906|Ga0207699_10465108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300025914|Ga0207671_10780628All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300025915|Ga0207693_10406310All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300025916|Ga0207663_11588187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300025960|Ga0207651_10463457Not Available1089Open in IMG/M
3300026075|Ga0207708_11091621All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300026088|Ga0207641_10255197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1639Open in IMG/M
3300026295|Ga0209234_1227914Not Available615Open in IMG/M
3300026308|Ga0209265_1222593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300026333|Ga0209158_1030056All Organisms → cellular organisms → Bacteria → Acidobacteria2358Open in IMG/M
3300026469|Ga0257169_1083356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300026538|Ga0209056_10697351All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300026550|Ga0209474_10012477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6798Open in IMG/M
3300027671|Ga0209588_1066385All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1166Open in IMG/M
3300027698|Ga0209446_1185217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4536Open in IMG/M
3300027738|Ga0208989_10104864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae961Open in IMG/M
3300027745|Ga0209908_10012793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1461Open in IMG/M
3300027767|Ga0209655_10083910All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300027842|Ga0209580_10255200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300027846|Ga0209180_10590665All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300027854|Ga0209517_10276448All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M
3300027895|Ga0209624_10161311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1484Open in IMG/M
3300027905|Ga0209415_10342015All Organisms → cellular organisms → Bacteria → Acidobacteria1253Open in IMG/M
3300028380|Ga0268265_11758859All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300030760|Ga0265762_1116673Not Available607Open in IMG/M
3300030879|Ga0265765_1057414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300031231|Ga0170824_109850607Not Available540Open in IMG/M
3300031231|Ga0170824_110683936All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300031231|Ga0170824_123356849All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031715|Ga0307476_10246447All Organisms → cellular organisms → Bacteria → Acidobacteria1304Open in IMG/M
3300031910|Ga0306923_12493355All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300032119|Ga0316051_1014805All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300032180|Ga0307471_100192466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2029Open in IMG/M
3300032180|Ga0307471_101292378All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300032180|Ga0307471_102284246All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300032205|Ga0307472_100605620All Organisms → cellular organisms → Bacteria → Acidobacteria968Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.20%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.68%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.84%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.84%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.84%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.84%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.84%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011089Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015087Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1076374023300004080Bog Forest SoilRWYEIDMNWYGIWALKKLGLARHVYRVKLSELDSKPEANAATPAPELASV*
Ga0066672_1064396313300005167SoilEVDVNWYGIWALKKLGLARHVYRVRLSELQRREEQGRSSAARRELVSV*
Ga0066680_1031426113300005174SoilDFNWYGIWALKKLGLARHVYRVKLSELRRREQQGLPAAAPRELVSA*
Ga0070683_10068588213300005329Corn RhizosphereGIWALKKLGLARHVYRVKLSELNEHDREKLVNVEPEPVSV*
Ga0070687_10005141243300005343Switchgrass RhizosphereGIWALKKLGLARHVYRVKLSELNELEREKLVPVEPEPVSV*
Ga0070714_10060473223300005435Agricultural SoilDINWYGIWTLKKLGLARHIYRVKLDELREDEAKLMKESHSELVSV*
Ga0070713_10140243413300005436Corn, Switchgrass And Miscanthus RhizosphereLKWYEIDLNWYGIWALKKLHLARHVYRVKLSELPEDEAEKVVSAKPELVSV*
Ga0070708_10121298113300005445Corn, Switchgrass And Miscanthus RhizosphereYGIWALKKLHLARHVYRVKLSELPEDEVEKVVSAKPELVSV*
Ga0066687_1079517023300005454SoilNWYGIWMLKKLGLARHVYRVRLSELRRREEEGLPAAAQSKLVSV*
Ga0070706_10139310623300005467Corn, Switchgrass And Miscanthus RhizosphereWYEIDMNWYGIWALNKLGLARQVYRVKLAELRRHEEEEGTPAAARTELVSA*
Ga0070731_1025454113300005538Surface SoilYGIWTLKKLGLARHVYRVRLSELERKQEAKATAPSPELASV*
Ga0070695_10087819713300005545Corn, Switchgrass And Miscanthus RhizosphereYEIDFNWYGIWALTKLGLARQVYRVKLSELREQEKEQGAPAEARSELVSAY*
Ga0066708_1078401623300005576SoilWYEVDVNWYGIWALQKLGLARHVYRVRLSELRRREEQGRSSAARRELVSV*
Ga0068866_1019875623300005718Miscanthus RhizosphereGIWALTKLGLARQVYRVKLSELRRQEEEQGAPAEARAEMVSA*
Ga0068863_10134623423300005841Switchgrass RhizosphereWALKKLGLARHVYRVKLSELKEQEREKLTPAEPELASL*
Ga0080026_1015564723300005952Permafrost SoilLRWYEIDFNWYGIWALTKLGLARQVYRVKLSELRQQEEEQGAPAEARAELVSA*
Ga0075015_10078126323300006102WatershedsDMNWYGIWTLKKLGLARQIYRVKLSELDRKEEGKAAPAPELVSV*
Ga0066665_1092263523300006796SoilNWYGIWTLKRLGLARHVYRVKLDELRAQEREKLAAVQPEPVSV*
Ga0079220_1027652913300006806Agricultural SoilKLGLARQVYRVKLSELRRQEEEQGAPAEARAEMVSA*
Ga0079220_1212253923300006806Agricultural SoilTKLGLARQVYRVKLSELRRREQEDGVPAAARPELVSA*
Ga0079219_1176919513300006954Agricultural SoilDLNWYGIWALKKLHLARHVYRVKLSELPEDEVEKVVSAKPELVSV*
Ga0099829_1004595353300009038Vadose Zone SoilDLNWYGIWALKKLGLARHVYRVKLAELREQEPAHQMERAHEQEKLAPAEPELVSI*
Ga0099829_1005428043300009038Vadose Zone SoilALKKLGLARHVYRVKLSELRQREEEDGVPAAARSEMVSA*
Ga0099828_1196310113300009089Vadose Zone SoilIDLNWYGIWALKKLGLARHVYRVKLAELREQEPAHQMERAHEQEKLAPAEPELVSI*
Ga0105240_1003235693300009093Corn RhizosphereWTLKKLGLARHIYRVKLDELREDEAKLMKESHSELVSV*
Ga0066709_10427414223300009137Grasslands SoilYEIDINWYGIWALKKLGLARHIYRVKLDELREDEAKLVKKSHPELVSV*
Ga0116222_120808113300009521Peatlands SoilIDMNWYGIWTLKKLGLARHVYRVKLDELARNEEAKAAAPTPTPELASV*
Ga0116218_114284213300009522Peatlands SoilIWTLKKLGLARHVYRVKLSELDRQGEAKVAAPAPELASV*
Ga0116135_103319613300009665PeatlandKLGLARHVYRVKLSELDQKQEAKAAAPTPELASV*
Ga0116217_1067264113300009700Peatlands SoilMNWYGIWALKKLGLARQVYRVKLSELSRQPPADSRQEQEEELPAARQELVSV*
Ga0116223_1090788613300009839Peatlands SoilKKLGLARHVYRVRLSELERKPQEAKATTSAPELASV*
Ga0126373_1284524013300010048Tropical Forest SoilDINWYGIWALKKLGLARHVYRVKLSELREDEAKKLASTRPELVSV*
Ga0074046_1082769623300010339Bog Forest SoilMRWYEIDMNWYGIWTLKKLGLARNIYRVTLSELERKEEAKAAAPARELVSV*
Ga0126376_1152309023300010359Tropical Forest SoilWALKKLGLARHVYRVKLSELREQEREKRAAATPPELASMSIPT*
Ga0134125_1050231533300010371Terrestrial SoilYGIWALKKLGLARHVYRVKLSELNEHEREKLVPAEPEPVSV*
Ga0134126_1112611223300010396Terrestrial SoilEIDLNWYGIWLLKKVGLARHVYRVKLDELNEREREKLAAPEPEPVSV*
Ga0134122_1128060813300010400Terrestrial SoilWYGIWALKKLGLARHVYRVKLSELNELEREKLVPVEPEPVSV*
Ga0138573_132309113300011089Peatlands SoilDMNWYGIWALKKLGLAHNIYRVKLSELNSEGEEAEPAPAPAQELVSV*
Ga0150983_1218524023300011120Forest SoilKLGLARHVYRVKLDELNRKEEANAATATPELASV*
Ga0137391_1146143233300011270Vadose Zone SoilEIDLNWYGIWTLKKLGLARHVYRVKLSELRENDREKLVATRPELASMNV*
Ga0137383_1061695623300012199Vadose Zone SoilGIWALKKLGLARHVYRVKLSELREPEREKLVTTAHPEPVAT*
Ga0137383_1091902323300012199Vadose Zone SoilTLKKLGLARHVYRVKLSELRENDREKLVATRPELASMNV*
Ga0137363_1132524723300012202Vadose Zone SoilLKKLGLARHVYRVKLSELQKKEGEKLVAAPPELVSINA*
Ga0137362_1093812313300012205Vadose Zone SoilIDMNWYGIWALTKLGLARQVYRVKLSELRQREDEGGAPAATRPELVSA*
Ga0137387_1063798923300012349Vadose Zone SoilWYGIWALKKLGLARHVYRVKLSELRRREQQGLPAAAPRELVSA*
Ga0137361_1100314013300012362Vadose Zone SoilLGLARQVYRVKLSELRQREDEGGAPAATRPELVSA*
Ga0137390_1017111313300012363Vadose Zone SoilWYEVDMNWYGIWALKKLGLARHVYRVKLSELRENESREVESREKDREKPAPAQPELVSV*
Ga0137395_1040084813300012917Vadose Zone SoilVNWYGIWALKKLGLARHVYRVRLSELQRREEQGRSSAARRELVSV*
Ga0137395_1110767823300012917Vadose Zone SoilLKWYEVDVNWYGIWALQKLGLARHVYRVRLSELRRREEQGRSSAARRELVSV*
Ga0137396_1057239013300012918Vadose Zone SoilGIWVLTKLGLARHVYRVKLSELRRREEEDGVPAAARTELVSA*
Ga0137407_1093379413300012930Vadose Zone SoilDLNWYGIWTLKKLGLARHVYRVKLSELPQPESKQEKLAPAPAEAELVSV*
Ga0164305_1174596223300012989SoilMRWYGVWGVTKLGLARQGDRVGLGELRRREEEAGVGRPAAA
Ga0157370_1060392023300013104Corn RhizosphereWYGIWTLKKLGLARHIYRVKLDELREDEAKLMKESRPELVSV*
Ga0163162_1203938923300013306Switchgrass RhizosphereTKLGLARQVYRVKLSELREQEKEQGAPAEARSELVSAY*
Ga0134079_1065335223300014166Grasslands SoilWYEIDLNWYGIWTLKKLGLARHIYRVKLDELQEHERQKLVSAQVEPEPASL*
Ga0163163_1023016013300014325Switchgrass RhizosphereFNWYGIWALTKLGLARQVYRVKLDELRRQEEEQGAPAEARAEMVSA*
Ga0182018_1048565423300014489PalsaWALKKLGLAHEVYRVKLSELRRQEEDEKEQVAAAAAHPELVSV*
Ga0182015_1007467713300014495PalsaGIWALKKLGLAHEVYRVKLSELRRQEEEEKEQVAAAPAHQELVSV*
Ga0182030_1025980913300014838BogDMNWYGIWALEKLGLARQIYRVDLSALPRKAEPEGGEAEAPAATQSELASV*
Ga0137405_142013133300015053Vadose Zone SoilLKWYEIDFNWYGIWTLTKLGLARQVYRVKLSELRQQEEEHGALAEARTEMVSA*
Ga0167637_103385913300015087Glacier Forefield SoilKLGLAKQVYRVKLSELRQQEEEQGTPAVAQPELVSI*
Ga0132255_10458171623300015374Arabidopsis RhizosphereDFNWYGIWALTKLGLAKQVYRVKLSELRRREDAEGTPATARPELVSA*
Ga0187816_1007309813300017995Freshwater SedimentKKLGLARHVYRVKLDELARQEEAKAAAPTPTPELASV
Ga0187805_1052417713300018007Freshwater SedimentMNWYGIWTLKKLGLARQVYRVKLSELDCKKEVKAAAATPELVSV
Ga0187864_1026085813300018022PeatlandIDMNWYGIWTLKKLGLARHVYRVKLDELGGKEEAKAAAPAPELVSV
Ga0187867_1006560633300018033PeatlandNWYGIWTLKKLGLARQVYRVKLSELDQKQEAKAAAPTPELASV
Ga0066669_1086149523300018482Grasslands SoilGIWALKKLGLARHVYRVKLDELQERQKLVPATRPEPVAT
Ga0210407_1129333213300020579SoilGLRWYEIDMNWYGIWTLKKLGLARHVYRVKLSELNRAEEAKAVAPELVSV
Ga0210403_1091901723300020580SoilLKKLGLARHVYRVKLSELERKQEAKAAAPAPELVSV
Ga0210399_1098428813300020581SoilMNWYGIWTLKKLGLARHVYRVKLSELERRQEAKETAPAPELVSV
Ga0210395_1035834423300020582SoilEIDMNWYGIWTLKKLGLARHVYRVKLSELDQKQEAKAAAPTPELASV
Ga0210395_1134082323300020582SoilLKKLGLARHVYRVKLSELRRRGEEGLPTATPSELVSA
Ga0210404_1007587213300021088SoilLTKFGLARQVYRVKLSELRQQEEEQGAPAEARAEMVSA
Ga0210404_1088626013300021088SoilLKWYEVDMNWYGIWALKKLGLARHVYRVKLSELRRRGEEGLPTATPSELVSA
Ga0210408_1028533833300021178SoilWTLKKLGLARHVYRVKLSELDRSAETAAAPSRELVSAMSRV
Ga0210383_1126145123300021407SoilGIWTLKKLGLARHVYRVKLSELERKQEAKEAAPASELVSV
Ga0210394_1016625133300021420SoilYEIDMNWYGIWTLKKLGLARHVYRVKLSELEQKQEAKAAAPTPELASV
Ga0210384_1139277013300021432SoilTLKKLGLARHVYRVKLDQLARKEEVKAATPSPELVSV
Ga0210402_1032427533300021478SoilEIDMNWYGIWILKKLGLARHVYRVKLSELDGKEEAKGTAPAPELASV
Ga0210402_1090908323300021478SoilYEIDFNWYGIWALNKLGLARQVYRVKLSELRQQEEEQGAPAEARAELVSA
Ga0210409_1069823213300021559SoilKKLGLARHVYRVKLDELNRKEEANAATATPELASV
Ga0224564_102401823300024271SoilTLKKLGLARHVYRVKLSELDRQGETKVAAPAPELASV
Ga0207692_1024725423300025898Corn, Switchgrass And Miscanthus RhizosphereWYEVDMNWYGIWALKKLGLARQVYRVKLSELQRREQEDGVSAAAQTELVSA
Ga0207699_1046510813300025906Corn, Switchgrass And Miscanthus RhizosphereWAFKKLGLARHVYQLKLSELKEHESEKLVAAAEPELVSP
Ga0207671_1078062813300025914Corn RhizosphereGLARQVYRVKLSELREQEKEQGAPAEARSELVSAY
Ga0207693_1040631023300025915Corn, Switchgrass And Miscanthus RhizosphereWYEIDFNWYGIWALTKLGLARQVYRVKLSELREQEKEQGAPAEARSELVSAY
Ga0207663_1158818713300025916Corn, Switchgrass And Miscanthus RhizosphereWTLKKLGLARHVYRVKLDELREHEREKLAAVQPEAEPVSV
Ga0207651_1046345713300025960Switchgrass RhizosphereYGIWALKKLGLARHVYRVKLSELNEHEREKLVNVEPEPVSV
Ga0207708_1109162123300026075Corn, Switchgrass And Miscanthus RhizosphereLNWYGIWALKKLGLARHVYRVKLSELNELEREKLVPVEPEPV
Ga0207641_1025519733300026088Switchgrass RhizosphereYGIWALKKLGLARHVYRVKLSELNELEREKLVPVEPEPVSV
Ga0209234_122791423300026295Grasslands SoilKKLGLARHIYRVKLSELREDESKLVKKAHGELVSV
Ga0209265_122259313300026308SoilKLGLARHVYQLKLSELKEHESEKLVAAGEPQPVSL
Ga0209158_103005643300026333SoilVDVNWYGIWALKKLGLARHVYRVRLSELQRREEQGRSSAARRELVSV
Ga0257169_108335613300026469SoilEIDFNWYGIWALTKLGLARQVYRVKLSELRQQEEEQGAPAEARAEMVSA
Ga0209056_1069735113300026538SoilALKKLGLARHVYRVRLSELRRREREEEEGTPAAARTELVSA
Ga0209474_1001247773300026550SoilKLGLARHVYRVRLSELRRREEEGLPAAAQSKLVSV
Ga0209588_106638513300027671Vadose Zone SoilNWYGIWALKKLGLARHVYRVRLSELQRREEQGRSSAARRELVSV
Ga0209446_118521713300027698Bog Forest SoilDMNWYGIWTLKKLGLARHVYRVKLSELDREAEAKAPTPARELASV
Ga0208989_1010486413300027738Forest SoilGLRWYEIDMNWYGIWMLKKLGLARHVYRVKLDELARKEEVKAATPTPELVSV
Ga0209908_1001279313300027745Thawing PermafrostVNWYGIWALKKLGLAHEVYRVKLSELRRQEEEEKEQVAAAPAHQELVSV
Ga0209655_1008391023300027767Bog Forest SoilKKLGLARHVYRVKLSELDQKQEAEAAAPTPELASV
Ga0209580_1025520013300027842Surface SoilFDINWYGIWALKKLGLARHVYRVKLSELREDEAKKAVAARPELVSV
Ga0209180_1059066513300027846Vadose Zone SoilKKLGLARHVYRVRLSELQRREEQGRSSAARRELVSV
Ga0209517_1027644823300027854Peatlands SoilWYGIWALKKLGLARQVYRVKLSELDRKEEAKAAAPARELVSV
Ga0209624_1016131133300027895Forest SoilNWYGIWTLKKLGLARHVYRVKLSELDRKQKAKAAAPTPELASV
Ga0209415_1034201523300027905Peatlands SoilKKLGLARHVYRVKLDELARQEEAKAPAQTPELASV
Ga0268265_1175885923300028380Switchgrass RhizosphereLNWYGIWALKKLGLARHVYRVKLSELNELEREKLVPVEPEPVSV
Ga0265762_111667323300030760SoilALKKLGLARHVYRVRLSELERKQEAKAATSAPELASV
Ga0265765_105741423300030879SoilWYGIWTLKKLGLARHLYRVKLSELEQKQEAKAAAPTPELASV
Ga0170824_10985060723300031231Forest SoilTLKKLGLARHVYRVKLDELREQEREKLATVQAEPVSV
Ga0170824_11068393613300031231Forest SoilLTKLGLARQVYRVKLSELRQQEEEQGAPAEARAEMVSA
Ga0170824_12335684913300031231Forest SoilINWYGIWTLKKLGLARHIYRVKLSELREDEAKLMKESRPELVSV
Ga0307476_1024644713300031715Hardwood Forest SoilGIWTLKKLGLARHVYRVKLDELAGKDEVKSAAPTPELVSV
Ga0306923_1249335513300031910SoilWTLQKLGLARHVYRVKLSELEKRGREKLTVPDTELVSV
Ga0316051_101480513300032119SoilMRTRFPPGTVCGYEVDMNWYGIWTLKKLGLARHVYRVKLSELDRQGETKVAAPAPELASV
Ga0307471_10019246633300032180Hardwood Forest SoilIDMNWYGIWALTKLGLARQVYRVKLAELRRHEEEEGTPAAAQTELVSV
Ga0307471_10129237813300032180Hardwood Forest SoilWYGIWTLKKLGLARHVYRVKLSELERRESQGLSTTATSELASV
Ga0307471_10228424613300032180Hardwood Forest SoilGIWALKKLGLARHVYRVKLSELRRGEQQGLPAAAPPRELVSA
Ga0307472_10060562013300032205Hardwood Forest SoilIWTLKKLGLARHVYRVKLSELRRREEEDGMPAAARSEMVSA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.