NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074677

Metagenome / Metatranscriptome Family F074677

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074677
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 39 residues
Representative Sequence RVTAKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS
Number of Associated Samples 104
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.68 %
% of genes near scaffold ends (potentially truncated) 96.64 %
% of genes from short scaffolds (< 2000 bps) 85.71 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(21.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.857 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.30%    β-sheet: 0.00%    Coil/Unstructured: 59.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00583Acetyltransf_1 8.40
PF14595Thioredoxin_9 8.40
PF01314AFOR_C 6.72
PF03928HbpS-like 5.88
PF00296Bac_luciferase 4.20
PF08240ADH_N 4.20
PF07690MFS_1 4.20
PF02627CMD 2.52
PF01636APH 2.52
PF00067p450 2.52
PF02515CoA_transf_3 2.52
PF01042Ribonuc_L-PSP 1.68
PF00903Glyoxalase 1.68
PF01769MgtE 1.68
PF05685Uma2 1.68
PF00206Lyase_1 0.84
PF04392ABC_sub_bind 0.84
PF05378Hydant_A_N 0.84
PF14833NAD_binding_11 0.84
PF12695Abhydrolase_5 0.84
PF00378ECH_1 0.84
PF07969Amidohydro_3 0.84
PF01186Lysyl_oxidase 0.84
PF02803Thiolase_C 0.84
PF13546DDE_5 0.84
PF02417Chromate_transp 0.84
PF04909Amidohydro_2 0.84
PF03706LPG_synthase_TM 0.84
PF07676PD40 0.84
PF05638T6SS_HCP 0.84
PF02738MoCoBD_1 0.84
PF12704MacB_PCD 0.84
PF08241Methyltransf_11 0.84
PF00932LTD 0.84
PF12697Abhydrolase_6 0.84
PF00202Aminotran_3 0.84
PF00857Isochorismatase 0.84
PF06155GBBH-like_N 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG2414Aldehyde:ferredoxin oxidoreductaseEnergy production and conversion [C] 6.72
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 4.20
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 2.52
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 2.52
COG2124Cytochrome P450Defense mechanisms [V] 2.52
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 2.52
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 1.68
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.68
COG1824Permease, similar to cation transportersInorganic ion transport and metabolism [P] 1.68
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 1.68
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.68
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.84
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.84
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.84
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.84
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 0.84
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.84
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.84
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.12 %
UnclassifiedrootN/A5.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_108160920All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300001661|JGI12053J15887_10561174All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300001661|JGI12053J15887_10620023All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300005341|Ga0070691_10458827All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005345|Ga0070692_11128800All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300005406|Ga0070703_10256008All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla712Open in IMG/M
3300005440|Ga0070705_100159315All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300005446|Ga0066686_10884829All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005468|Ga0070707_100564039All Organisms → cellular organisms → Bacteria → Proteobacteria1101Open in IMG/M
3300005530|Ga0070679_100136955All Organisms → cellular organisms → Bacteria → Proteobacteria2430Open in IMG/M
3300005540|Ga0066697_10205204All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300005540|Ga0066697_10302184All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria941Open in IMG/M
3300005549|Ga0070704_101718326All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300005558|Ga0066698_10546090All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005561|Ga0066699_10151451All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300005561|Ga0066699_10317263Not Available1111Open in IMG/M
3300005598|Ga0066706_10099666All Organisms → cellular organisms → Bacteria → Proteobacteria2106Open in IMG/M
3300005764|Ga0066903_102501594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 1009271000Open in IMG/M
3300005921|Ga0070766_10910776All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300005985|Ga0081539_10306506All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300006031|Ga0066651_10024705All Organisms → cellular organisms → Bacteria2633Open in IMG/M
3300006031|Ga0066651_10056344All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300006046|Ga0066652_100928528All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300006049|Ga0075417_10621964All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300006794|Ga0066658_10107349All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300006845|Ga0075421_102227321All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300006847|Ga0075431_100545595All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300006847|Ga0075431_100941249All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300006852|Ga0075433_11135636All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300007255|Ga0099791_10488470All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300007255|Ga0099791_10567722All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300009137|Ga0066709_103555702All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300009137|Ga0066709_103689163All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009147|Ga0114129_11695412All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria771Open in IMG/M
3300009156|Ga0111538_11041315All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300009174|Ga0105241_11765053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium603Open in IMG/M
3300009177|Ga0105248_10450028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1451Open in IMG/M
3300009807|Ga0105061_1042307All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300010046|Ga0126384_10093106All Organisms → cellular organisms → Bacteria2203Open in IMG/M
3300010046|Ga0126384_10687192All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300010046|Ga0126384_10786585All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300010047|Ga0126382_11750027All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium582Open in IMG/M
3300010301|Ga0134070_10336877All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla582Open in IMG/M
3300010303|Ga0134082_10250180All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300010304|Ga0134088_10130704All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300010362|Ga0126377_11441405All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria762Open in IMG/M
3300010362|Ga0126377_11935625All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla665Open in IMG/M
3300010373|Ga0134128_11784850All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium677Open in IMG/M
3300010376|Ga0126381_104511985All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300010391|Ga0136847_12307707Not Available596Open in IMG/M
3300010398|Ga0126383_11131007All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla873Open in IMG/M
3300012198|Ga0137364_10080248All Organisms → cellular organisms → Bacteria2254Open in IMG/M
3300012204|Ga0137374_10022783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7052Open in IMG/M
3300012360|Ga0137375_11239325All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria568Open in IMG/M
3300012397|Ga0134056_1238389All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300012918|Ga0137396_11089838All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300012922|Ga0137394_10030992All Organisms → cellular organisms → Bacteria → Proteobacteria4341Open in IMG/M
3300012922|Ga0137394_10155217All Organisms → cellular organisms → Bacteria1949Open in IMG/M
3300012948|Ga0126375_11431665All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300012971|Ga0126369_11687506All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium723Open in IMG/M
3300012971|Ga0126369_13061375All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012988|Ga0164306_10891334All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium724Open in IMG/M
3300013100|Ga0157373_10915735All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300014166|Ga0134079_10101155All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300014873|Ga0180066_1043111All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300015245|Ga0137409_11528036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium517Open in IMG/M
3300015259|Ga0180085_1232709All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria544Open in IMG/M
3300015261|Ga0182006_1165355All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium744Open in IMG/M
3300017657|Ga0134074_1018464Not Available2288Open in IMG/M
3300018027|Ga0184605_10029066All Organisms → cellular organisms → Bacteria2269Open in IMG/M
3300018063|Ga0184637_10070000All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2149Open in IMG/M
3300018429|Ga0190272_13033951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300018431|Ga0066655_11169418All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300018433|Ga0066667_10047359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2567Open in IMG/M
3300018482|Ga0066669_10041860All Organisms → cellular organisms → Bacteria2818Open in IMG/M
3300019229|Ga0180116_1314672All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300019360|Ga0187894_10021556All Organisms → cellular organisms → Bacteria → Proteobacteria4517Open in IMG/M
3300019360|Ga0187894_10366689All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300019487|Ga0187893_10594250All Organisms → cellular organisms → Bacteria → Proteobacteria703Open in IMG/M
3300019789|Ga0137408_1152473All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300019886|Ga0193727_1130486All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300020082|Ga0206353_10189581All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium726Open in IMG/M
3300020580|Ga0210403_10373541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1166Open in IMG/M
3300021088|Ga0210404_10168611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1158Open in IMG/M
3300021178|Ga0210408_10024869All Organisms → cellular organisms → Bacteria → Proteobacteria4758Open in IMG/M
3300025001|Ga0209618_1052913All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300025327|Ga0209751_10197248All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300025549|Ga0210094_1083259All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300025921|Ga0207652_10165959All Organisms → cellular organisms → Bacteria → Proteobacteria1980Open in IMG/M
3300025922|Ga0207646_11926890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300025961|Ga0207712_10799370All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium829Open in IMG/M
3300026088|Ga0207641_11438407All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium691Open in IMG/M
3300026301|Ga0209238_1032258Not Available1942Open in IMG/M
3300026323|Ga0209472_1158683Not Available834Open in IMG/M
3300026324|Ga0209470_1255164All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300026374|Ga0257146_1075980All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium547Open in IMG/M
3300026528|Ga0209378_1158512Not Available880Open in IMG/M
3300027654|Ga0209799_1052548All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla911Open in IMG/M
3300027846|Ga0209180_10058323All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300027909|Ga0209382_10757809All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300027909|Ga0209382_11657072All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300027947|Ga0209868_1012805Not Available829Open in IMG/M
3300028381|Ga0268264_10626661All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300028809|Ga0247824_10381641All Organisms → cellular organisms → Bacteria810Open in IMG/M
(restricted) 3300031248|Ga0255312_1109363All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031720|Ga0307469_11371018All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300031720|Ga0307469_12525400All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300031740|Ga0307468_101508099All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria623Open in IMG/M
3300031765|Ga0318554_10003797All Organisms → cellular organisms → Bacteria6861Open in IMG/M
3300031820|Ga0307473_11222432All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium559Open in IMG/M
3300031854|Ga0310904_10772097All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium670Open in IMG/M
3300031901|Ga0307406_11279485All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300031949|Ga0214473_12013388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium563Open in IMG/M
3300032001|Ga0306922_10169320All Organisms → cellular organisms → Bacteria → Proteobacteria2340Open in IMG/M
3300032180|Ga0307471_104012604All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium520Open in IMG/M
3300032516|Ga0315273_11200950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla955Open in IMG/M
3300033407|Ga0214472_11014058All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla733Open in IMG/M
3300033813|Ga0364928_0062420All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300033814|Ga0364930_0336220All Organisms → cellular organisms → Bacteria507Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks2.52%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.68%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.68%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.68%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.84%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.84%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.84%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300025001Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027947Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10816092033300000955SoilQRVTAKLAPRYEKPFSAYGEYRPWRTGVASNIERTFAMVS*
JGI12053J15887_1056117423300001661Forest SoilALAPTYEKPFSVYGDYRPWRAGLLRNIERTYAMVS*
JGI12053J15887_1062002323300001661Forest SoilRVTDKLAPTYEKPFSTYGDYRPWRAGLLLNIERTYAMVS*
Ga0070691_1045882723300005341Corn, Switchgrass And Miscanthus RhizosphereEEVKQRVTARLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS*
Ga0070692_1112880023300005345Corn, Switchgrass And Miscanthus RhizosphereKQRVTAKLAPRYEKPFSAYGEYRPWRTGLAANIERTFGMVG*
Ga0070703_1025600823300005406Corn, Switchgrass And Miscanthus RhizosphereEETKRRVTDKLAPTYEKPFSAYGDYRPWRGGLALNIERTYAMVG*
Ga0070705_10015931513300005440Corn, Switchgrass And Miscanthus RhizosphereQRVIAKLAPRHEKTFSAYNDYRPWRTGAAANIERTFAMVS*
Ga0066686_1088482923300005446SoilDEVKQRVTAKLAPRYEKPFSTYGDYRPWRTGLAANIERTFGMVS*
Ga0070707_10056403923300005468Corn, Switchgrass And Miscanthus RhizosphereKERLPAVLGPVYEKPFSVYGDYRPWRLGLLGNIERTYAMVS*
Ga0070679_10013695533300005530Corn RhizosphereEVKQRVTAALAPTYEKPFSAYGEYRPWRTGLAGNVERTFAMVS*
Ga0066697_1020520423300005540SoilRVPERLALVYEKPFSLYGHYRPWRQGLRSNIERTYTMVS*
Ga0066697_1030218433300005540SoilEALAATYEKPFSAYGVYRPWRTGLLLNIERTYAMVS*
Ga0070704_10171832613300005549Corn, Switchgrass And Miscanthus RhizosphereVKQRVIAKLAPRHEKTFLAYNDYRPWRTGAAANIERTFAMVS*
Ga0066698_1054609013300005558SoilKQRVTAKLAPRYEKPFSVYGEYRPWRTGVLANIERTFAMVS*
Ga0066699_1015145113300005561SoilQRRVPEALAPTYEKPFSAYGDYRPWRAGLLLNIERTYAMVS*
Ga0066699_1031726323300005561SoilEVKQRVTTALAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS*
Ga0066706_1009966613300005598SoilVTTALAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS*
Ga0066903_10250159423300005764Tropical Forest SoilDRLAPAYEQAFSKYGTYRPWRTGILTNIERTFAMVS*
Ga0070766_1091077613300005921SoilVPARLAPTYEKAFATYEHYRPWRAGLLANIDRTYAMVS*
Ga0081539_1030650623300005985Tabebuia Heterophylla RhizosphereVKQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYAMVS*
Ga0066651_1002470513300006031SoilRVTAKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS*
Ga0066651_1005634433300006031SoilRLAPVYEKPFSLYGHYRPWRAALRANIERTYAMVS*
Ga0066652_10092852833300006046SoilPEALAPTYEKPFSAYGDYRPWRAGLLLNIERTYAMVS*
Ga0075417_1062196413300006049Populus RhizosphereQRVTAALAPAYERPFSAYGDYRPWRAGLAANIERTFAMVS*
Ga0066658_1010734913300006794SoilTLEEVQQRVPERLAPVYEKPFSLYGHYRPWRAALRSNIERTYAMVS*
Ga0075421_10222732113300006845Populus RhizosphereTTRLAPTYEPVFSTHQHYRPWRQGLLANIERTYAMVS*
Ga0075431_10054559523300006847Populus RhizosphereLDEVKARVPAKLAQIYEKPFSTYGEYRPWRTGILANIERTYAMVS*
Ga0075431_10094124933300006847Populus RhizosphereTAKLAPRYEKPFSAYGEYRPWRTGLAANIERTFGMVG*
Ga0075433_1113563613300006852Populus RhizosphereKLAPRYEKPFSAYGDYRPWRTGAAANIERTFGMVS*
Ga0099791_1048847013300007255Vadose Zone SoilVPAALAGTYEKPFSVYADYRPWRTGILANVERTYAMVS*
Ga0099791_1056772213300007255Vadose Zone SoilVTAKLAPRYEKPFSAYGEYRPWRTGVAANIERTFGMVS*
Ga0066709_10355570223300009137Grasslands SoilEVKERVPPKLAPAHEKPFSAYPDYRPWRQGLLGNIERTYALLSQVK*
Ga0066709_10368916323300009137Grasslands SoilLEEAQQRVPERLALVYEKPFSLYGHYRPWRQGLRGNIERTYAMVV*
Ga0114129_1169541213300009147Populus RhizosphereEVKQRVPAALAGTYEKPFSKYGDYRPWRTGILANIERTYAMVS*
Ga0111538_1104131533300009156Populus RhizosphereSALAPTYEKAFSVYGEYRPWRAGLAANVERTFAMVS*
Ga0105241_1176505323300009174Corn RhizosphereVLGPIYEKPFSVYGDYRPWRAGLLGNIERTYAMVS*
Ga0105248_1045002813300009177Switchgrass RhizospherePRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS*
Ga0105061_104230723300009807Groundwater SandLAPTYEKPFSAYGEYRPWRTGLAGNIERTFTMVS*
Ga0126384_1009310633300010046Tropical Forest SoilVKQRVPEKLAPAYEKPFSKYGEYRPWRAGLLANIERTFAMVS*
Ga0126384_1068719213300010046Tropical Forest SoilRLAPTYEPAFATYNHYRPWRAGLLANIERTYPMVS*
Ga0126384_1078658513300010046Tropical Forest SoilATLDEVKQRVIAKLAPRYEKPSSAYGEYRPWRTGAAANIERTFGTVS*
Ga0126382_1175002713300010047Tropical Forest SoilIANLAPRYEKPFSTYGEYRPWRTGAAANVERTFGMVS*
Ga0134070_1033687723300010301Grasslands SoilTDRLAPAYEKPFSAYGDYRPWRAGLALNIQRTYAMVS*
Ga0134082_1025018013300010303Grasslands SoilAKLAPTYEKPFSTYGHYRPWRQGILGNIERAYAMVS*
Ga0134088_1013070413300010304Grasslands SoilLEEAQQRVPERLALVYEKPFSLYGHYLPLRQGLRSNIERTYTMVS*
Ga0126377_1144140513300010362Tropical Forest SoilPPKLAPTYEKAFSTYGDYRPWRQGLLANIERTYAMVA*
Ga0126377_1193562513300010362Tropical Forest SoilTQRRVTDKLAPAYEKPFSAYGDYRPWRAGLARNIERTFAMVS*
Ga0134128_1178485023300010373Terrestrial SoilAALAGTYEKPFSKYGDYRPWRAGILANIERTYAMVS*
Ga0126381_10451198523300010376Tropical Forest SoilRRVTDSLVPDYEKPFSTYGDYRPLRAGLARNIERTYSTVS*
Ga0136847_1230770723300010391Freshwater SedimentVPERLAPTYEKPFSTYGDYRPWRAGLLRNIERTYAMVS*
Ga0126383_1113100713300010398Tropical Forest SoilDKLAPAYEKPFSAYGDYRPWRAGLARNVERTYAMIS*
Ga0137364_1008024853300012198Vadose Zone SoilLAPTYEKAFSAYGDYRPWRTGVLGNIERTYAVVS*
Ga0137374_1002278313300012204Vadose Zone SoilTLEEVQRRVTDRLAPAYEKPFSAYGDYRPWRAGLALNVQRTYAMVS*
Ga0137375_1123932513300012360Vadose Zone SoilVKQRVTAKLAPRYEKPFSTYGDYRPWRTGVLANIERTFAMVS*
Ga0134056_123838913300012397Grasslands SoilAKLAPTYEKAFSVYGHYRPWRQGIMANIERTYAMVG*
Ga0137396_1108983813300012918Vadose Zone SoilKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS*
Ga0137394_1003099213300012922Vadose Zone SoilRVPARLAPTYEKAFATYEHYRPWRAGLHANIERTYAMVS*
Ga0137394_1015521713300012922Vadose Zone SoilTARLAPTYEPAFAAYQHYRPWRQGLLGNIERTYPMVS*
Ga0126375_1143166513300012948Tropical Forest SoilKLAPRYEKPFSTYGDYRPWRTGVLANIERTFGMVS*
Ga0126369_1168750633300012971Tropical Forest SoilKLAPTYEKAFSTYGDYRPWRQGLLANIERTYAMVG*
Ga0126369_1306137523300012971Tropical Forest SoilLGPAYEKSFSVYGEYRPWRAGLLGNIERTYAMVS*
Ga0164306_1089133423300012988SoilQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS*
Ga0157373_1091573513300013100Corn RhizosphereRVTARLSPTHEKAFAEYNDYRPWRTGLLGNIERTFAMVS*
Ga0134079_1010115513300014166Grasslands SoilLAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS*
Ga0180066_104311113300014873SoilLDRLAETYEPAFAAYQHYRPWRQGLLANIERTYPMVS*
Ga0137409_1152803613300015245Vadose Zone SoilPAALAGTYEKPFSRYGDYRPWRTGILANIERTYAMVS*
Ga0180085_123270913300015259SoilVQQRVPERLAPTYEKPFSTYGNYRPWRAGLLRNIERTYAMVS*
Ga0182006_116535513300015261RhizosphereVKQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS*
Ga0134074_101846433300017657Grasslands SoilVQQRVPAKLAPTYEKSFSVYGHYRPWRQGIMANIERAYAMVG
Ga0184605_1002906643300018027Groundwater SedimentQRVTAALAPTYEKAFSAYGEYRPWRTGLAGNIERTFAMVS
Ga0184637_1007000013300018063Groundwater SedimentAALAPTYEKPFSAYGEYRPWRTGLAANIERTFAMVS
Ga0190272_1303395123300018429SoilLLGPVYEKPFSAYGDYRPWRLGLLGNIERTYAMVS
Ga0066655_1116941813300018431Grasslands SoilTAKLAPRYEKPFSVYGEYRPWRTGVLANIERTFAMVS
Ga0066667_1004735933300018433Grasslands SoilPAKLAPTYEKPFSTYGHYRPWRQGILGNIERAYAMVS
Ga0066669_1004186033300018482Grasslands SoilRVTAKLAPTYEKPFSRYGEYRPWRAGLLANIERTFAMVS
Ga0180116_131467213300019229Groundwater SedimentRVTDKLAPTYEKPFSAYGDYRPWRAGLARNIERTYAMVS
Ga0187894_1002155633300019360Microbial Mat On RocksMDCCVHDAPTYEPAFAAYQHYRPWRQGLLANIERTHPMVS
Ga0187894_1036668923300019360Microbial Mat On RocksRVTAKLAPVHEKSFSAYADYRPWRAGLLGNIERTFAMVS
Ga0187893_1059425023300019487Microbial Mat On RocksMDCCGHEGPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS
Ga0137408_115247333300019789Vadose Zone SoilRVSAKLAPRYEKPFSAYGEYRPWSTGVLANIERTFAMVS
Ga0193727_113048613300019886SoilQRVTARLAPTYEPAFAAYQHYRPWRQGLLGNIERTYPMVS
Ga0206353_1018958123300020082Corn, Switchgrass And Miscanthus RhizospherePPRLAPTYEKAFATYEHYRPWRAGLLANIERTYALVS
Ga0210403_1037354133300020580SoilRVPARLAPTYEKAFATYEHYRPWRAGLLANIDRTYAMVS
Ga0210404_1016861133300021088SoilARLAPTYEKAFATYEHYRPWRAGLLANIDRTYAMVS
Ga0210408_1002486963300021178SoilEVKQRVPPRLAPTYEKAFATYEHYRPWRAGLLANIERTYAMVS
Ga0209618_105291313300025001SoilRLAPIYEPAFSTYQHYRPWRQGLLANIERTYAMVS
Ga0209751_1019724813300025327SoilRLAPKYEKPFSTYGDYRPWRAGLLRNIERTYAMVS
Ga0210094_108325913300025549Natural And Restored WetlandsQRRVTDKLAPTYERAFSAYGDYRPWRAGLALNVERTYAMVN
Ga0207652_1016595933300025921Corn RhizosphereDEVKQRVTAALAPTYEKPFSAYGEYRPWRTGLAGNVERTFAMVS
Ga0207646_1192689023300025922Corn, Switchgrass And Miscanthus RhizosphereKERLPAVLGPIYEKPFSVYGDYRPWRLGLLGNIERTYAMVS
Ga0207712_1079937023300025961Switchgrass RhizosphereVKHRVPPKLAPTYEKAFSTYGDYRPWRQGLLANIERTYSMVG
Ga0207641_1143840713300026088Switchgrass RhizosphereRVIAKLAPRHEKTFLAYNDYRPWRTGAAANIERTFAMVS
Ga0209238_103225823300026301Grasslands SoilEEVQQRVPAKLAPTYEKSFSVYGHYRPWRQGIMANIERTYAMVG
Ga0209472_115868323300026323SoilKQRVTTALAPTYEKAFSAYGEYRPWRAGLAGNVERTFAMVS
Ga0209470_125516423300026324SoilKQRVTAKLAPRYEKPFSAYGDYRPWRTGLAANIERTFGMVS
Ga0257146_107598013300026374SoilVKQRVIAKLAPRHEKTFSAYNDYRPWRTGAAANIERTFAMVS
Ga0209378_115851213300026528SoilLLVDERVPERLALVYEKPFSLYGHYRPWRQGLRSNIERTYTMVS
Ga0209799_105254813300027654Tropical Forest SoilEETQRRVTDRLAPAYEKPFSTYGDYRPWRTGLARNIERTFSMVS
Ga0209180_1005832313300027846Vadose Zone SoilRLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMAS
Ga0209382_1075780913300027909Populus RhizosphereVKARVPAKLAQIYEKPFSTYGEYRPWRTGILANIERTYAMVS
Ga0209382_1165707213300027909Populus RhizosphereTTRLAPTYEPVFSTHQHYRPWRQGLLANIERTYAMVS
Ga0209868_101280523300027947Groundwater SandTAKLAPRYEKPFSTYGDYRPWRTGVLANIERTFAMVS
Ga0268264_1062666123300028381Switchgrass RhizosphereRRVTERLAPAYEKPFSVYGDYRPWRAGLALNIQRTYTMVS
Ga0247824_1038164113300028809SoilRAVTRCLTSSRLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS
(restricted) Ga0255312_110936313300031248Sandy SoilVKQRVTTKLAPVYEKPFSAYGDYRPWRAGLAANVERTFAMVS
Ga0307469_1137101823300031720Hardwood Forest SoilATAKLAPRYEKAFSAYGDYRPWRTGVLANIERTFGMVS
Ga0307469_1252540023300031720Hardwood Forest SoilTDRLAPAYEKPFSAYGDYRPWRAGLALNIQRTYAMVS
Ga0307468_10150809923300031740Hardwood Forest SoilRVPAALAGTYEKPFSKYGDYRPWRTGILANIERTYAMVS
Ga0318554_10003797103300031765SoilVKQRVIAKLAPRYEKPFSAYGEYRPWRTGVAANIERTFGMVS
Ga0307473_1122243223300031820Hardwood Forest SoilTLEETQRRVTERLAPTYEKPFSTYGDYRPWRAGLLRNVERAYAMVG
Ga0310904_1077209713300031854SoilKLAPRHEKTFSAYNDYRPWRTGAAANIERTFAMVS
Ga0307406_1127948513300031901RhizosphereQVKERVTARLAPIHEAKFAAYADYRPWRAGLAGNVERTFAMVS
Ga0214473_1201338823300031949SoilKQRVPAKLAAAYEKPFSAYADYRPWRTGVLGNIERTYAMVS
Ga0306922_1016932033300032001SoilPDRLAPAYEQAFSKYGAYRPWRTGILTNIERVFAMVS
Ga0307471_10401260413300032180Hardwood Forest SoilKQRVSAKLAPRYEKPFSAYGDYRPWRTGVLANIERTFPMVS
Ga0315273_1120095033300032516SedimentAQRRVPDRLAPTYEKPFSTYGDYRPWRAGLLRNIERTYAMVS
Ga0214472_1101405823300033407SoilPDRLAPTYEKPFSTYGDYRPWRAGLLRNIERTYAMVS
Ga0364928_0062420_3_1133300033813SedimentARLAPTYEPAFAAYQHYRPWRQGLLANIERTYPMVS
Ga0364930_0336220_387_5033300033814SedimentVPDELAPVYEQAFSKYAAYRPWRQGILTNIERIFATVG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.