NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074773

Metagenome Family F074773

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074773
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 41 residues
Representative Sequence AQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKNEKKD
Number of Associated Samples 93
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.80 %
% of genes from short scaffolds (< 2000 bps) 81.51 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified bacterial viruses (53.782 % of family members)
NCBI Taxonomy ID 12333
Taxonomy All Organisms → Viruses → unclassified bacterial viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(21.849 % of family members)
Environment Ontology (ENVO) Unclassified
(38.655 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(46.218 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.47%    β-sheet: 0.00%    Coil/Unstructured: 48.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.59 %
UnclassifiedrootN/A29.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10248089All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl761Open in IMG/M
3300002482|JGI25127J35165_1009544All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2482Open in IMG/M
3300002835|B570J40625_100709271Not Available899Open in IMG/M
3300005940|Ga0073913_10047889All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl675Open in IMG/M
3300006734|Ga0098073_1006120All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2378Open in IMG/M
3300006734|Ga0098073_1034107All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl708Open in IMG/M
3300006802|Ga0070749_10480835Not Available678Open in IMG/M
3300006802|Ga0070749_10594101All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium597Open in IMG/M
3300006875|Ga0075473_10401191All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium554Open in IMG/M
3300007214|Ga0103959_1279643All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium1859Open in IMG/M
3300007345|Ga0070752_1222559All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl744Open in IMG/M
3300007538|Ga0099851_1057002All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1528Open in IMG/M
3300007538|Ga0099851_1064046All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1431Open in IMG/M
3300007539|Ga0099849_1357939Not Available518Open in IMG/M
3300007540|Ga0099847_1242437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.519Open in IMG/M
3300007541|Ga0099848_1227845All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl659Open in IMG/M
3300007541|Ga0099848_1318540All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl531Open in IMG/M
3300007542|Ga0099846_1066439All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1351Open in IMG/M
3300007542|Ga0099846_1169590All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl780Open in IMG/M
3300007542|Ga0099846_1277461All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl577Open in IMG/M
3300007960|Ga0099850_1222745All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl735Open in IMG/M
3300007974|Ga0105747_1138825All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl780Open in IMG/M
3300007992|Ga0105748_10183024All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl867Open in IMG/M
3300009009|Ga0105105_10144310Not Available1193Open in IMG/M
3300009085|Ga0105103_10786634Not Available552Open in IMG/M
3300009466|Ga0126448_1031037All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1259Open in IMG/M
3300009703|Ga0114933_10195902All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1371Open in IMG/M
3300010299|Ga0129342_1026990All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2325Open in IMG/M
3300010299|Ga0129342_1195665All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl720Open in IMG/M
3300010300|Ga0129351_1015550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → unclassified Balneolaceae → Balneolaceae bacterium3162Open in IMG/M
3300010300|Ga0129351_1084367All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1282Open in IMG/M
3300010300|Ga0129351_1375164Not Available532Open in IMG/M
3300010318|Ga0136656_1025085Not Available2166Open in IMG/M
3300010318|Ga0136656_1133433Not Available856Open in IMG/M
3300010354|Ga0129333_11148502All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl647Open in IMG/M
3300010368|Ga0129324_10090657All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1330Open in IMG/M
3300010370|Ga0129336_10193986All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1158Open in IMG/M
3300010389|Ga0136549_10030751All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl3017Open in IMG/M
3300010389|Ga0136549_10031915All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium2941Open in IMG/M
3300010389|Ga0136549_10031916All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium2941Open in IMG/M
3300010389|Ga0136549_10137959All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1108Open in IMG/M
3300010389|Ga0136549_10251209Not Available750Open in IMG/M
3300011984|Ga0119931_1047701Not Available521Open in IMG/M
3300012920|Ga0160423_11110792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.528Open in IMG/M
(restricted) 3300013132|Ga0172372_10977596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.512Open in IMG/M
3300013372|Ga0177922_10794016Not Available540Open in IMG/M
3300015050|Ga0181338_1022012All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl995Open in IMG/M
3300015050|Ga0181338_1038257All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl718Open in IMG/M
3300017736|Ga0181365_1127045All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl610Open in IMG/M
3300017747|Ga0181352_1021509All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1994Open in IMG/M
3300017774|Ga0181358_1282095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.512Open in IMG/M
3300017778|Ga0181349_1099934All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1087Open in IMG/M
3300017778|Ga0181349_1287133Not Available537Open in IMG/M
3300017956|Ga0181580_10667530Not Available664Open in IMG/M
3300020056|Ga0181574_10486757All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl696Open in IMG/M
3300020074|Ga0194113_10706941Not Available699Open in IMG/M
3300020161|Ga0211726_10607836All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.928Open in IMG/M
3300020179|Ga0194134_10035475All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2952Open in IMG/M
3300020183|Ga0194115_10229360All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl893Open in IMG/M
3300020193|Ga0194131_10041532All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium3367Open in IMG/M
3300020196|Ga0194124_10489487All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl540Open in IMG/M
3300020380|Ga0211498_10409849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.507Open in IMG/M
3300020394|Ga0211497_10020812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.3282Open in IMG/M
3300020395|Ga0211705_10075828All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1212Open in IMG/M
3300020433|Ga0211565_10039435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2008Open in IMG/M
3300020553|Ga0208855_1013676All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1281Open in IMG/M
3300021091|Ga0194133_10470367All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl664Open in IMG/M
3300021962|Ga0222713_10809924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.522Open in IMG/M
3300022190|Ga0181354_1130589Not Available800Open in IMG/M
3300022190|Ga0181354_1156370All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl709Open in IMG/M
3300022198|Ga0196905_1083006Not Available871Open in IMG/M
3300022198|Ga0196905_1171495Not Available552Open in IMG/M
3300022198|Ga0196905_1192251All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.514Open in IMG/M
3300022200|Ga0196901_1075818All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1208Open in IMG/M
3300022200|Ga0196901_1104444All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl985Open in IMG/M
3300022407|Ga0181351_1195206All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl682Open in IMG/M
3300024262|Ga0210003_1157970Not Available965Open in IMG/M
3300024262|Ga0210003_1227799All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl748Open in IMG/M
3300025093|Ga0208794_1021475Not Available1348Open in IMG/M
3300025132|Ga0209232_1214437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.579Open in IMG/M
3300025647|Ga0208160_1097645All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl765Open in IMG/M
3300025647|Ga0208160_1111801All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl697Open in IMG/M
3300025687|Ga0208019_1010014All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl4085Open in IMG/M
3300025687|Ga0208019_1062940All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1237Open in IMG/M
3300025769|Ga0208767_1046741All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2058Open in IMG/M
3300025769|Ga0208767_1259997Not Available535Open in IMG/M
3300025889|Ga0208644_1052059All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2262Open in IMG/M
3300027693|Ga0209704_1175289Not Available624Open in IMG/M
3300027732|Ga0209442_1167623All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl834Open in IMG/M
3300027762|Ga0209288_10206289Not Available643Open in IMG/M
3300027763|Ga0209088_10221958Not Available798Open in IMG/M
3300027785|Ga0209246_10390160Not Available524Open in IMG/M
3300027798|Ga0209353_10043370All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2073Open in IMG/M
3300027900|Ga0209253_10980086Not Available586Open in IMG/M
3300027917|Ga0209536_101783907All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl742Open in IMG/M
3300028025|Ga0247723_1100181All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl732Open in IMG/M
3300029306|Ga0135212_1007502All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl885Open in IMG/M
3300031539|Ga0307380_10500485Not Available1068Open in IMG/M
3300031673|Ga0307377_10539514Not Available843Open in IMG/M
3300031772|Ga0315288_11316448All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl612Open in IMG/M
3300031885|Ga0315285_10435877All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl923Open in IMG/M
3300031963|Ga0315901_10967477All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl598Open in IMG/M
3300031997|Ga0315278_11237137All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl731Open in IMG/M
3300032046|Ga0315289_10118090All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl3068Open in IMG/M
3300032050|Ga0315906_11176019Not Available559Open in IMG/M
3300032053|Ga0315284_10175723All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2793Open in IMG/M
3300032093|Ga0315902_10559822All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl974Open in IMG/M
3300032093|Ga0315902_11328312Not Available504Open in IMG/M
3300032118|Ga0315277_10605211All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1075Open in IMG/M
3300032156|Ga0315295_11190741All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl747Open in IMG/M
3300032516|Ga0315273_10703098All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1328Open in IMG/M
3300033994|Ga0334996_0553066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.504Open in IMG/M
3300034061|Ga0334987_0227979Not Available1287Open in IMG/M
3300034063|Ga0335000_0807401Not Available504Open in IMG/M
3300034101|Ga0335027_0460699All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl807Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous21.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.76%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient8.40%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.20%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.20%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment4.20%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.36%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.36%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.52%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.68%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.68%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.84%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.84%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.84%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.84%
Drinking Water Treatment PlantEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.84%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.84%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.84%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.84%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.84%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.84%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.84%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.84%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011984Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020056Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020395Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1024808913300000882Freshwater And MarineQLQENVLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEA*
JGI25127J35165_100954443300002482MarineQLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK*
B570J40625_10070927113300002835FreshwaterAQLQANVLSNPDKYDEKTVKQARLRQTLVGLKKNKDSKKES*
Ga0073913_1004788913300005940SandGITTAQLQENVLSAPEKYDAETVKQARLRQTLVGLKKKKDEKKTET*
Ga0098073_100612053300006734MarineITSAQLQANVLANPDKYDEKTVKQARLRQTLVGLKKKKDSKKAES*
Ga0098073_103410713300006734MarineGITSAQLQENVLSNPDEYDEKTVKQARLRQTLVGLHKKKKNKE*
Ga0070749_1048083513300006802AqueousQLQENVLSNPDKYDDKTVKQARLRKTLVGLKQKKKSKTNG*
Ga0070749_1059410123300006802AqueousGISPAQLQANVLSNPKKYDEKTVKQANLRRTLVGLNKKKKAK*
Ga0075473_1040119123300006875AqueousSPAQLQANVLSNPKKYDEKTVKQANLRRTLVGLNKKKKAK*
Ga0103959_127964313300007214Freshwater LakeVLSNPDNYDEKTVKQARLRQTLVGLHKKKKESKS*
Ga0070752_122255913300007345AqueousAKKKGITTAQLQENVLANPDKYDEKTVKQANLRKTLVGLHKKKKEKKAD*
Ga0099851_105700243300007538AqueousTSAQLQENVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKKSEE*
Ga0099851_106404613300007538AqueousENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE*
Ga0099849_135793913300007539AqueousKKGITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKDSKKTEE*
Ga0099847_124243713300007540AqueousKKGITTAQLQENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE*
Ga0099848_122784513300007541AqueousVLANPEKYDEKTVKQANLRKTLVGLKKKKKEKQG*
Ga0099848_131854013300007541AqueousQENVLSNPDEYDEKTVKQARLRQTLVGLKKRKDKK*
Ga0099846_106643913300007542AqueousRKGITTAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKKEKSEG*
Ga0099846_116959013300007542AqueousLQENVLANPEKYDEKTVKQARLRQTLVGLNKKKKEKKTEG*
Ga0099846_127746113300007542AqueousGITTAQLQENVLSNPDEYDEKTVKQARLRQTLVGLKKRKDKK*
Ga0099850_122274523300007960AqueousVLANPDKYDEKTVKQANLRKTLVGLHKKKKEKKAD*
Ga0105747_113882523300007974Estuary WaterAQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKSEKKG*
Ga0105747_134012323300007974Estuary WaterVLAEPDKYDEKTIKQATLRKTLVQLNKNKKEKVTDG*
Ga0105748_1018302413300007992Estuary WaterNVLSDPDKYDDTTVKQANLRKTLVGLHQKKKADKAED*
Ga0105105_1014431013300009009Freshwater SedimentAQLQANVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKES*
Ga0105103_1078663413300009085Freshwater SedimentTAQLQENVLSNPDDYDDKTVKQARLRQTLVGLKKKKDKK*
Ga0126448_103103713300009466Meromictic PondLQENVLSNPDEYDEKTVKQARLRKTLVGLKKRKDKK*
Ga0114933_1019590213300009703Deep SubsurfaceNVLADPDKYDEKTVKQARLRKTLVGLNKKKKAKEE*
Ga0129342_102699013300010299Freshwater To Marine Saline GradientKKGITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKYSKKAEE*
Ga0129342_119566513300010299Freshwater To Marine Saline GradientLQENVLSNPDDYDEKTVKQARLRKTLVGLKKRKDKK*
Ga0129351_101555013300010300Freshwater To Marine Saline GradientNPEKYDDKTVKQANLRKTLVGLHKDKKSKANKKD*
Ga0129351_108436733300010300Freshwater To Marine Saline GradientGITSAQLQENVLADPEKYDERTVKQARLRKTLVGLHGKKKSKK*
Ga0129351_137516423300010300Freshwater To Marine Saline GradientKKRGITSAQLQANVLANPEKYDDKTVKQANLRKTLVGLHKDKKSKANKKD*
Ga0136656_102508513300010318Freshwater To Marine Saline GradientITSAQLQKNVLSNPDKYDDKTVKQAQLRETLVGLHKKKKAKKAEN*
Ga0136656_113343313300010318Freshwater To Marine Saline GradientLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKGSKED*
Ga0129333_1114850223300010354Freshwater To Marine Saline GradientNVLANPDKYDEKTVKQARLRQTLVGLKKKKKEKSEG*
Ga0129324_1009065733300010368Freshwater To Marine Saline GradientQENVLANPEKYDEKTVKQANLRKTLVGLHKKKKSNKAD*
Ga0129336_1019398613300010370Freshwater To Marine Saline GradientLQENVLSNPDEYDEKTVKQARLRKTLVGLRKRKDKE*
Ga0136549_1003075113300010389Marine Methane Seep SedimentVLANPDKYDEKTVKQARLRKTLVGLKKKKDSKKTEE*
Ga0136549_1003191513300010389Marine Methane Seep SedimentKRKGITSAQLQENVLADPDKYDEKTVKQARLRQTLVGLHKKKKQKQTES*
Ga0136549_1003191613300010389Marine Methane Seep SedimentKRKGITSAQLQENVLADPDKYDEKTVKQARLRQTLVGLHKKKKQKQTED*
Ga0136549_1013795933300010389Marine Methane Seep SedimentQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKKEKSEG*
Ga0136549_1025120923300010389Marine Methane Seep SedimentNPEKYDDKTVKQANLRKTLVGLNKDKKSKAKNKD*
Ga0139557_106041013300011010FreshwaterLAEPDKYDEKTIKQATLRKTLVQLNKNKKEKVTDG*
Ga0119931_104770113300011984Drinking Water Treatment PlantGITTAQLQENVLSNPDDYDEKTVKQARLRQTLVGLKKKKDKK*
Ga0160423_1111079213300012920Surface SeawaterTTAQLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK*
(restricted) Ga0172372_1097759623300013132FreshwaterVLSNPEKYDEKTVKQARLRQTLVGLKKKKKEKSEG*
Ga0177922_1079401623300013372FreshwaterSKGITTAQLQENVLADPDKYDKSTVRQANLRKTLVSLKKKKYRKAEED*
Ga0181338_102201233300015050Freshwater LakeLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEG*
Ga0181338_103825713300015050Freshwater LakeQLQENVLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEG*
Ga0181365_112704513300017736Freshwater LakeGITTAQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPEDXWRKTQGLT
Ga0181352_102150943300017747Freshwater LakeITSAQLQENVLSSPDEYDEKTVKQARLRQTLVGLKKKKKQRADT
Ga0181358_128209523300017774Freshwater LakeLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEG
Ga0181349_109993413300017778Freshwater LakeKGITTAQLQENVLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEA
Ga0181349_128713313300017778Freshwater LakeKKGITSAQLQENVLSAPDKYDDKTVKQANLRRTLVGLQKKKTKK
Ga0181580_1066753013300017956Salt MarshNVLSNPDKYDDKTVKQARLRKTLVGLKQRKKAKENG
Ga0181575_1021187333300020055Salt MarshLSNPDKYDDKTVKQAQLRETLVGLHKKKKAKKAED
Ga0181574_1048675723300020056Salt MarshRRGITSAQLQKNVLSNPDKYDDKTVKQAQLRETLVGLHKKKKAKKAED
Ga0194113_1070694113300020074Freshwater LakeITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKNKDNKQES
Ga0211726_1060783613300020161FreshwaterQLQENVLSNPEKYDEKTVKQANLRKTLVGLHKKKKEKTEDXWLEIHAWN
Ga0194134_1003547513300020179Freshwater LakeKKGITSAQLQENVLSNPEKYDEKTVKQARLRKTLVGLKKKKNKNNG
Ga0194115_1022936013300020183Freshwater LakeTAQLQENVLSNPEKYDEKTVKQARLRQTLVGLHNKKKAKS
Ga0194131_1004153263300020193Freshwater LakeNVLANPDKYDEKTVKQARLRKTLVGLKKNKDNKQES
Ga0194124_1048948723300020196Freshwater LakeENVLANPEKYDERTVKQANLRKTLVGLHNKKKNKE
Ga0211498_1040984913300020380MarineQLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK
Ga0211497_1002081263300020394MarineNVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK
Ga0211705_1007582813300020395MarineLQENVLSNPDDYDEKTVKQANLRKTLVRLQKNKKAKKEXKTIG
Ga0211565_1003943513300020433MarineAEKKGITTAQLQENVLSNPDDYDERTVKQARLRKTLVGLNKKKKDKKK
Ga0208855_101367633300020553FreshwaterKKGITSAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKDQKKSEG
Ga0194133_1047036723300021091Freshwater LakeKGITSAQLQENVLSNPEKYDEKTVKQARLRKTLVGLKKKKNKNNG
Ga0222713_1080992413300021962Estuarine WaterAQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKNEKKD
Ga0181354_113058913300022190Freshwater LakeTTAQLQENVLADPDKYDKSTVRQANLRKTLVSLKKKKYRKAEED
Ga0181354_115637013300022190Freshwater LakeQLQENVLSNPDEYNAETIKQARLRQTLVGLKKKKDAKKTEG
Ga0196905_108300613300022198AqueousRKGITSAQLQANVLANPDKYDEKTVKQARLRKTLVGLKKKKGSKED
Ga0196905_117149523300022198AqueousLQANVLANPDKYDEKTVKQARLRQTLVGLKKNKDSKKSED
Ga0196905_119225113300022198AqueousQLQENVLANPEKYDEKTVKQANLRKTLVGLKKKKKEKQG
Ga0196901_107581833300022200AqueousKRKGITTAQLQENVLSNPDEYDEKTVKQARLRQTLVGLKKRKDKK
Ga0196901_110444433300022200AqueousLQENVLSNPDKYDEKTVKQARLRQTLVGLHKKKKESKK
Ga0181351_119520623300022407Freshwater LakeITTAQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0210003_115797013300024262Deep SubsurfaceSNVLGNPDKYDEKTVKQARLRQTLVGLHKKKKAKEENS
Ga0210003_122779923300024262Deep SubsurfaceGITSSQLQENVLAEPAKYDDKTVKQARLRKTLVGLHNKKKDKE
Ga0208794_102147513300025093MarineAKRKGITTAQLQANVEANPEKYDEKTQKQARLRKTLVGLNKKKKAKE
Ga0209232_121443723300025132MarineAKKRGITSAQLQENVLANPDEYDEKTVKQANLRKTLVGLDKKKKAKK
Ga0208160_109764523300025647AqueousLQENVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKKSEE
Ga0208160_111180113300025647AqueousLQENVLANPEKYDEKTVKQARLRQTLVGLNKKKKEKKTEG
Ga0208019_101001463300025687AqueousSAQLQANVLADPDKYDEKTVKQANLRKTLVGIQKRKKEKKNEGSST
Ga0208019_106294033300025687AqueousSAQLQENVLSNPDKYDKKTVKQARLRQTLVGLHKKKKESKK
Ga0208767_104674143300025769AqueousENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE
Ga0208767_125999713300025769AqueousAQLQENVLSNPDKYDDKTVKQARLRKTLVGLKQKKKSKTNG
Ga0208644_105205943300025889AqueousRKGITSAQLQENVLSNPDKYDEKTVKQARLRKTLVSLKKNKTNKPEE
Ga0209704_117528923300027693Freshwater SedimentAQLQENVLANPDDYDKSTVKQANLRKTLVSLKKKKYRKAEED
Ga0209442_116762313300027732Freshwater LakeNVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0209288_1020628913300027762Freshwater SedimentSAQLQANVLSNPDKYDEKTVKQARLRKTLVGLKKKKDSKES
Ga0209088_1022195823300027763Freshwater LakeTSAQLQENVLASPEKYDDKTVKQARLRETLVGLHKKKQGKK
Ga0209246_1039016023300027785Freshwater LakeQENVLSAPDKYDDKTIKQANLRKTLVGLQKKKTKK
Ga0209353_1004337013300027798Freshwater LakeLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0209354_1008731213300027808Freshwater LakeSQLQENVLAEPDKYDEKTIKQANLRKTLVKLNNRKKEKAS
Ga0209253_1098008623300027900Freshwater Lake SedimentKGITTAQLQENVLSSPEKYDERTVKQARLRETLVGLHGKKKQKS
Ga0209536_10178390723300027917Marine SedimentRGITTAQLQENVLANPEKYDEKTVKQANLRKTLVGLKKKKKAKE
Ga0247723_110018123300028025Deep Subsurface SedimentNVLSNPEKYDEKTVKQARLRQTLVGLKKKKKEKSEG
Ga0135212_100750213300029306Marine HarborLQENVLSNPDDYDEKTVRQARLRKTLVGLKKRRDDQPKKEKKDA
Ga0307380_1050048533300031539SoilLQENVLANPEDYDKSTVKQANLRKTLVSLKKKKYRKAEEN
Ga0307377_1053951413300031673SoilLQENVLANPEDYDKSTVKQANLRKTLVSLKKKKYRKAEED
Ga0315288_1131644823300031772SedimentAQLQENVLANPDEYNAETIKQARLRQTLVGLKKKKDAKKTEA
Ga0315285_1043587713300031885SedimentLANPDEYNAETIKQARLRQTLVGLKKNKDAKKTEA
Ga0315901_1096747723300031963FreshwaterKGITSAQLQENVLANPDKYDEKTVKQARLRQTLVGLKKKKDSKKSEE
Ga0315278_1123713713300031997SedimentRKGITTAQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0315289_1011809013300032046SedimentSQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0315906_1117601913300032050FreshwaterTAQLQENVLSNPDDYDDKTVKQARLRQTLVGLKKKKDKK
Ga0315284_1017572313300032053SedimentENVLSDPDKYDETTQKQANLRKTLVGLHHKKKAKKAED
Ga0315902_1055982213300032093FreshwaterKKKGITTAQLQENVLSNPDKYDEKTVKQARLRQTLVGLHGKKKKAKG
Ga0315902_1132831223300032093FreshwaterKSKGITTAQLQENVLADPEKYDKSTVRQANLRKTLVSLKKKKYRKAEED
Ga0315277_1060521133300032118SedimentVLSDPDKYDETTQKQANLRKTLVGLHHKKKAKKAED
Ga0315295_1119074123300032156SedimentVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0315273_1070309813300032516SedimentKGITTSQLQENVLSNPDKYNDTTVKQANLRKTLVGLHQRKKQKTPED
Ga0334996_0553066_369_5033300033994FreshwaterTTAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKDQKKSEG
Ga0334987_0227979_1172_12853300034061FreshwaterNVLANPEDYDKSTVKQANLRKTLVSLKKKKYRKAEED
Ga0335000_0807401_380_5023300034063FreshwaterQLQANVLSNPDKYDEKTVKQARLRQTLVGLKKNKDSKKES
Ga0335027_0460699_679_8073300034101FreshwaterAQLQENVLSNPDKYDEKTVKQARLRQTLVGLKKKKDQKKSEG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.