NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074825

Metagenome Family F074825

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074825
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 65 residues
Representative Sequence MTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN
Number of Associated Samples 87
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 74.58 %
% of genes near scaffold ends (potentially truncated) 40.34 %
% of genes from short scaffolds (< 2000 bps) 78.99 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (74.790 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(52.101 % of family members)
Environment Ontology (ENVO) Unclassified
(80.672 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.756 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 56.12%    β-sheet: 0.00%    Coil/Unstructured: 43.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF08299Bac_DnaA_C 69.75
PF08291Peptidase_M15_3 7.56
PF03796DnaB_C 2.52
PF10544T5orf172 0.84
PF13884Peptidase_S74 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 69.75
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 2.52
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 2.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A74.79 %
All OrganismsrootAll Organisms25.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10013697All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.4116Open in IMG/M
3300004097|Ga0055584_100234411Not Available1871Open in IMG/M
3300004097|Ga0055584_101109312Not Available827Open in IMG/M
3300005747|Ga0076924_1066641Not Available1462Open in IMG/M
3300006025|Ga0075474_10103739All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300006025|Ga0075474_10276695Not Available500Open in IMG/M
3300006026|Ga0075478_10088419Not Available994Open in IMG/M
3300006026|Ga0075478_10133599Not Available779Open in IMG/M
3300006027|Ga0075462_10133183Not Available764Open in IMG/M
3300006637|Ga0075461_10021178All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300006802|Ga0070749_10101574Not Available1700Open in IMG/M
3300006802|Ga0070749_10215845Not Available1095Open in IMG/M
3300006802|Ga0070749_10364515Not Available801Open in IMG/M
3300006802|Ga0070749_10453152Not Available703Open in IMG/M
3300006810|Ga0070754_10070419Not Available1788Open in IMG/M
3300006810|Ga0070754_10178730Not Available999Open in IMG/M
3300006810|Ga0070754_10242558Not Available825Open in IMG/M
3300006810|Ga0070754_10453335Not Available556Open in IMG/M
3300006868|Ga0075481_10162383All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300006869|Ga0075477_10094545Not Available1284Open in IMG/M
3300006870|Ga0075479_10105413Not Available1168Open in IMG/M
3300006874|Ga0075475_10289286Not Available678Open in IMG/M
3300006919|Ga0070746_10346286Not Available674Open in IMG/M
3300007229|Ga0075468_10017918All Organisms → Viruses → Predicted Viral2648Open in IMG/M
3300007234|Ga0075460_10107664Not Available997Open in IMG/M
3300007344|Ga0070745_1168759Not Available821Open in IMG/M
3300007539|Ga0099849_1004752All Organisms → cellular organisms → Bacteria → FCB group6235Open in IMG/M
3300007542|Ga0099846_1093499Not Available1111Open in IMG/M
3300007609|Ga0102945_1069641Not Available659Open in IMG/M
3300007609|Ga0102945_1072044Not Available645Open in IMG/M
3300007960|Ga0099850_1004069All Organisms → cellular organisms → Bacteria → FCB group6843Open in IMG/M
3300007960|Ga0099850_1084789Not Available1319Open in IMG/M
3300008012|Ga0075480_10394638Not Available683Open in IMG/M
3300008012|Ga0075480_10404387Not Available672Open in IMG/M
3300009001|Ga0102963_1131265Not Available1014Open in IMG/M
3300009433|Ga0115545_1086166All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300009433|Ga0115545_1160445Not Available781Open in IMG/M
3300009435|Ga0115546_1239070Not Available623Open in IMG/M
3300010368|Ga0129324_10397208Not Available533Open in IMG/M
3300017697|Ga0180120_10197927Not Available833Open in IMG/M
3300017708|Ga0181369_1013386Not Available2065Open in IMG/M
3300017710|Ga0181403_1123208Not Available541Open in IMG/M
3300017717|Ga0181404_1112567Not Available664Open in IMG/M
3300017725|Ga0181398_1005075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED373500Open in IMG/M
3300017727|Ga0181401_1140255Not Available594Open in IMG/M
3300017728|Ga0181419_1001576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium7627Open in IMG/M
3300017734|Ga0187222_1096350Not Available670Open in IMG/M
3300017739|Ga0181433_1128329Not Available604Open in IMG/M
3300017741|Ga0181421_1013215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium2282Open in IMG/M
3300017742|Ga0181399_1056429Not Available1016Open in IMG/M
3300017748|Ga0181393_1000263Not Available19601Open in IMG/M
3300017752|Ga0181400_1161564Not Available632Open in IMG/M
3300017755|Ga0181411_1004742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Sednavirus → Synechococcus virus SRIP24705Open in IMG/M
3300017755|Ga0181411_1037452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371524Open in IMG/M
3300017755|Ga0181411_1080203Not Available978Open in IMG/M
3300017756|Ga0181382_1083927Not Available877Open in IMG/M
3300017759|Ga0181414_1005415All Organisms → Viruses → Predicted Viral3612Open in IMG/M
3300017762|Ga0181422_1103993Not Available886Open in IMG/M
3300017765|Ga0181413_1013023All Organisms → Viruses → Predicted Viral2592Open in IMG/M
3300017765|Ga0181413_1046901All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1343Open in IMG/M
3300017765|Ga0181413_1054971Not Available1232Open in IMG/M
3300017781|Ga0181423_1283006Not Available614Open in IMG/M
3300017782|Ga0181380_1062904Not Available1315Open in IMG/M
3300017786|Ga0181424_10044629Not Available1921Open in IMG/M
3300017950|Ga0181607_10069925Not Available2300Open in IMG/M
3300018036|Ga0181600_10077456All Organisms → Viruses → Predicted Viral2027Open in IMG/M
3300018041|Ga0181601_10100675Not Available1869Open in IMG/M
3300020053|Ga0181595_10107421Not Available1352Open in IMG/M
3300020173|Ga0181602_10280318Not Available698Open in IMG/M
3300020177|Ga0181596_10101637All Organisms → Viruses → Predicted Viral1451Open in IMG/M
3300020177|Ga0181596_10251683Not Available736Open in IMG/M
3300020191|Ga0181604_10085063All Organisms → Viruses → Predicted Viral1731Open in IMG/M
3300021335|Ga0213867_1002291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber8490Open in IMG/M
3300021373|Ga0213865_10360378Not Available658Open in IMG/M
3300021425|Ga0213866_10020267All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Peregrinibacteria → Candidatus Peribacteria → unclassified Candidatus Peribacteria → Candidatus Peribacteria bacterium3963Open in IMG/M
3300021958|Ga0222718_10185456Not Available1147Open in IMG/M
3300021964|Ga0222719_10495645Not Available735Open in IMG/M
3300022057|Ga0212025_1006334Not Available1625Open in IMG/M
3300022068|Ga0212021_1029811Not Available1060Open in IMG/M
3300022069|Ga0212026_1036558Not Available729Open in IMG/M
3300022071|Ga0212028_1054310Not Available749Open in IMG/M
3300022168|Ga0212027_1035787Not Available649Open in IMG/M
3300022178|Ga0196887_1022808All Organisms → Viruses → Predicted Viral1834Open in IMG/M
3300022187|Ga0196899_1026115Not Available2090Open in IMG/M
3300022187|Ga0196899_1029742Not Available1925Open in IMG/M
3300022187|Ga0196899_1083273Not Available975Open in IMG/M
3300022198|Ga0196905_1182334Not Available531Open in IMG/M
3300022927|Ga0255769_10247272Not Available754Open in IMG/M
(restricted) 3300023109|Ga0233432_10015516All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium5782Open in IMG/M
3300025151|Ga0209645_1030708All Organisms → Viruses → Predicted Viral1979Open in IMG/M
3300025610|Ga0208149_1082660Not Available789Open in IMG/M
3300025630|Ga0208004_1033571Not Available1483Open in IMG/M
3300025646|Ga0208161_1110716Not Available741Open in IMG/M
3300025653|Ga0208428_1016598All Organisms → Viruses → Predicted Viral2471Open in IMG/M
3300025653|Ga0208428_1127283Not Available698Open in IMG/M
3300025671|Ga0208898_1006461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Pseudarcicella → Pseudarcicella hirudinis6379Open in IMG/M
3300025671|Ga0208898_1024335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M012593Open in IMG/M
3300025671|Ga0208898_1105434Not Available847Open in IMG/M
3300025671|Ga0208898_1117438Not Available774Open in IMG/M
3300025674|Ga0208162_1004955Not Available6194Open in IMG/M
3300025674|Ga0208162_1071328Not Available1098Open in IMG/M
3300025771|Ga0208427_1060848All Organisms → Viruses → Predicted Viral1368Open in IMG/M
3300025815|Ga0208785_1148011Not Available540Open in IMG/M
3300025818|Ga0208542_1078009Not Available984Open in IMG/M
3300025818|Ga0208542_1179239Not Available559Open in IMG/M
3300025828|Ga0208547_1068299Not Available1168Open in IMG/M
3300025828|Ga0208547_1071707Not Available1129Open in IMG/M
3300025853|Ga0208645_1053143Not Available1917Open in IMG/M
3300025853|Ga0208645_1068894Not Available1590Open in IMG/M
3300025853|Ga0208645_1164214Not Available828Open in IMG/M
3300025889|Ga0208644_1257582Not Available718Open in IMG/M
3300026097|Ga0209953_1005985All Organisms → Viruses → Predicted Viral2789Open in IMG/M
3300027917|Ga0209536_100662765Not Available1297Open in IMG/M
3300027917|Ga0209536_100989029All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300029448|Ga0183755_1023330Not Available1981Open in IMG/M
3300034374|Ga0348335_046057Not Available1730Open in IMG/M
3300034374|Ga0348335_060554Not Available1390Open in IMG/M
3300034375|Ga0348336_091851Not Available1058Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous52.10%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater19.33%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.56%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water4.20%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.52%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.52%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.68%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.68%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.68%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.84%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020053Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026097Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1001369753300000116MarineMGIVTILCFVSSMTYIGWLFGITQKIEASEKSTTEAFKEGYIKGYFDGHARASKKEKPYYEDFPEMGIN*
Ga0055584_10023441123300004097Pelagic MarineMGIVTILCFVSSMTYIGWLFGITQKIEASEESTTKAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN*
Ga0055584_10110931213300004097Pelagic MarineMEIIAVLSLSITTGYIGYIFGASMQQIEASEKSTTEAFKEGYIKGYFDGHARAAKKEKPYYEDFPEMGIN*
Ga0076924_106664143300005747MarineMGIVSILFFSASMTYIGWIFGIAQHIEASEKSTTEAYKEGYIKGYFDGHATKKEKPYFEDFPKMGTN*
Ga0075474_1010373913300006025AqueousMEIVSVLFFSASMTYIGWMFGIAQQIEASEKSTTEA
Ga0075474_1027669523300006025AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN*
Ga0075478_1008841933300006026AqueousMEIITILCFVSSMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHA
Ga0075478_1013359913300006026AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRA
Ga0075462_1013318323300006027AqueousMEIIAVLSLSITTGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN*
Ga0075461_1002117823300006637AqueousMEIVSVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGTN*
Ga0070749_1010157423300006802AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRAAKKEKPYFEDFPSMRIN*
Ga0070749_1021584533300006802AqueousMEIITILCFVSRMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFP
Ga0070749_1036451523300006802AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN*
Ga0070749_1045315213300006802AqueousMEIIAVLSLSITTGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFP
Ga0070754_1007041953300006810AqueousMEIIAVLSLSITTGYIGFIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHARAAKKEKPYYEDFPEMGIN*
Ga0070754_1017873033300006810AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEM
Ga0070754_1024255823300006810AqueousMGIVSVLSLSIMFCYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEM
Ga0070754_1045333523300006810AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN*
Ga0075481_1016238313300006868AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKG
Ga0075477_1009454553300006869AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0075479_1010541313300006870AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN*
Ga0075475_1028928613300006874AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDG
Ga0070746_1034628613300006919AqueousMEIVSVLFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRAAKKEKPYFEDFPSMRIN*
Ga0075468_1001791813300007229AqueousMTYIGWLFGITQKIEASEESTTKAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN*
Ga0075460_1010766433300007234AqueousMEIITILCFVSSMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHANAT
Ga0070745_116875913300007344AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRATKKEKPYFEDFPEMG
Ga0099849_1004752113300007539AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHATKKEKPYFED
Ga0099846_109349933300007542AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFP
Ga0102945_106964113300007609Pond WaterMEIITLLSLSITTGYVGYIFGSSMKQVETSERSITEAFKEGYIKGYTDCWAAKESDKKYYDEFPPMGTN*
Ga0102945_107204413300007609Pond WaterMEIITLLSLSITTGYVGYIFGSSMKQVETSERSITEAYKEGYIKGYTDCWAAKESDKKYYDDGY*
Ga0099850_100406943300007960AqueousVIVMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN*
Ga0099850_108478923300007960AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHATKKEKPYFEDFPEMGIN*
Ga0075480_1039463823300008012AqueousVIVMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATK
Ga0075480_1040438713300008012AqueousMEIIAVLSLSITTGYIGFIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHARAAKKEKP
Ga0102963_113126513300009001Pond WaterRVFRASTKNKLIIMEIVTILCFVSSMTYVGWLFGIAQKIEASEKSITEAFKEGYIKGDTDCWAAKESDKKYYDEFPPMGTN*
Ga0115545_108616613300009433Pelagic MarineTTGYIGYIFGASMQQIEASEKSTTEAFKEGYIKGYFDGHARATKKEKPYYEDFPEMGIN*
Ga0115545_116044513300009433Pelagic MarineMEIIAVLSLSITTGYIGFIFGASMRQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN*
Ga0115546_123907023300009435Pelagic MarineMEIIAVLSLSITTGYIGFIFGASMQQIEASEKSTTEAFKEGYIKGYFDGHAHATKKEKPYYEDFPEMGIN*
Ga0129324_1039720813300010368Freshwater To Marine Saline GradientSVFRESSTNKVIFMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN*
Ga0180120_1019792713300017697Freshwater To Marine Saline GradientIISVLSLSITFGYIGFIFGSSMKQIEASERSTTEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0181369_101338633300017708MarineMEIIAVFSLSITTGYIGFIFGSSMKQIETSERSITEAFKEGYMKGYFDGHAHATKKEKPYFEDFPKMGIN
Ga0181403_112320823300017710SeawaterMEIITLLSLSITAGYVGFIFGSSMKQIEASEKSTAEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGIN
Ga0181404_111256723300017717SeawaterMEIVTILCFVSSMTYVGWLFGIAQKIEASEKSTAEAFKEGYIKGYIDGHANAAKK
Ga0181398_100507543300017725SeawaterMGIVTILCFVSSMTYVGWLFGITQKIEASEESTTKAFKEGYIKGYIDGHANAAKKEKPYYKDFPKMGIN
Ga0181401_114025523300017727SeawaterMEIVTILCFVSSMTYVGWLFGITQKIEASEESTTKAFKEGYIKGYIDGHANAAKKEKPYYKDFP
Ga0181419_100157623300017728SeawaterMEIVTLLSLSITAGYVGFIFGSSMKQIETSERSITEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGIN
Ga0187222_109635013300017734SeawaterMEIVTILCFVSSMTYVGWLFGIAQKIEASEKSTTEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGTN
Ga0181433_112832923300017739SeawaterMEIVTLLSLSITTGYIGFIFGSSMKQIETSERSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGTN
Ga0181421_101321553300017741SeawaterMEIIAVLSLSITTGYIGFIFGSSMKQIETSERSITEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGIN
Ga0181399_105642923300017742SeawaterMEIVTILCFVSSMTYVGWLFGITQKIEASEKSTAEAFKEGYIKGYIDGHANAAKKEKPYYEDFPNMGIN
Ga0181393_1000263373300017748SeawaterMEIIAVLSLSITTGYIGFIFGSSMKQIEASEKSTTEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGIN
Ga0181400_116156423300017752SeawaterMEIVTILCFVSSMTYVGWLFGITQKIEASEESTTKAFKEGYIKGYIDGHANAAKKEKPYYKDFPKMGIN
Ga0181411_100474253300017755SeawaterMEIITLLSLSITAGYVGFIFGSSMKQIEALEKSTAEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGIN
Ga0181411_103745223300017755SeawaterMGIVTILCFVSSMTYVGWLFGITQKIEASEKSTTEAFKEGYIKGYIDGHANAAKKEKPYYEDFPNMGIN
Ga0181411_108020323300017755SeawaterMEIIAVLSLSITTGYIGFIFGSSMKQIEASEKSTTEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGTN
Ga0181382_108392733300017756SeawaterMEIVTILCFVSSMTYVGWLFGIAQKIETSEKSTTEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGTN
Ga0181414_100541533300017759SeawaterMEIIAVLSLSITTGYVGFIFGSSMKQIETSERSITEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGTN
Ga0181422_110399323300017762SeawaterVEIVTILCFVSSMTYVGWLFGIAQKIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGIN
Ga0181413_101302343300017765SeawaterMEIITLLSLSITAGYVGFIFGSSMKQIEASEKSTAEAFKEGYIKGYIDGHANATKKEKHYYEDFPKMGIN
Ga0181413_104690143300017765SeawaterMEIIAVLSLSITTGYIGFIFGSSMKQIETSERSITEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGTN
Ga0181413_105497123300017765SeawaterMGIVTILCFVSSMTYVGWLFGITQKIEASEKSTAEAFKEGYIKGYIDGHANAAKKEKPYYEDFPNMGIN
Ga0181423_128300613300017781SeawaterTTGYVGFIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGTN
Ga0181380_106290423300017782SeawaterMEIVTILCFVSSMTYVGWLFGIAQKIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPKMGIN
Ga0181424_1004462943300017786SeawaterMEIVTILFFVSSMTYVGWLFGIAQKIEASEKSTTEAFKEGYIKGYIDGHANATKKEKPYYEDFPKMGIN
Ga0181607_1006992543300017950Salt MarshMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYYEDFPEMGIN
Ga0181600_1007745643300018036Salt MarshMEIVSVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGRATKKEKPYYEDFPEMGIN
Ga0181601_1010067543300018041Salt MarshMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0181595_1010742143300020053Salt MarshMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN
Ga0181602_1028031813300020173Salt MarshLSIMFCYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGRATKKEKPYYEDFPEMGIN
Ga0181596_1010163753300020177Salt MarshSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGI
Ga0181596_1025168313300020177Salt MarshMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEK
Ga0181604_1008506343300020191Salt MarshMEIVSVLSLSIMFCYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGRATKKEKPYYEDFPEMGIN
Ga0213867_100229193300021335SeawaterMEIIAVLSLSITTGYIGFIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHARAAKKEKPYYEDFPEMGIN
Ga0213865_1036037823300021373SeawaterMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN
Ga0213866_1002026743300021425SeawaterMTIVSVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN
Ga0222718_1018545633300021958Estuarine WaterMEIITLLSLSITTGYVGYIFGSSMKQIEASERSITEAFKEGYIKGYTDCWAAKESDKKYYDEFPPMGTN
Ga0222719_1049564513300021964Estuarine WaterMEIITLLSLSITTGYVGYIFGSSMKQVETSERSITEAFKEGYIKGYTDCWAAKESDKKYYDEFPPMGTN
Ga0212025_100633453300022057AqueousMEIITILCFVSSMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0212021_102981113300022068AqueousMEIIAVLSLSITTGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKE
Ga0212026_103655813300022069AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHANATKKE
Ga0212028_105431033300022071AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN
Ga0212027_103578733300022168AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSTTEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0196887_102280853300022178AqueousMGIVTILCFVSSMTYIGWLFGITQKIEASEESTTKAFKEGYIKGYFDGHANATKKEKPYYEDFPEMGIN
Ga0196899_102611523300022187AqueousMEIITILCFVSSMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN
Ga0196899_102974233300022187AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRAAKKEKPYFEDFPSMRIN
Ga0196899_108327323300022187AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFED
Ga0196905_118233413300022198AqueousLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPDMGIN
Ga0255769_1024727233300022927Salt MarshFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
(restricted) Ga0233432_1001551663300023109SeawaterMEIITLLSLSITAGYVGFIFGSSMKQIETSERSITEAFKEGYIKGYTDCWAAKESDKKYYDEFPPMGTN
Ga0209645_103070813300025151MarineMTIVAYLSSIITFTYIGYIFGSSMKQVEASERSTTEAFKEGYIKGYFDGHAHATKKEKPYYEDFPKMGIN
Ga0208149_108266013300025610AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFED
Ga0208004_103357143300025630AqueousMEIVSVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGTN
Ga0208161_111071623300025646AqueousMTIISVLSLSITFCYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0208428_101659863300025653AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN
Ga0208428_112728313300025653AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYF
Ga0208898_100646113300025671AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPE
Ga0208898_102433553300025671AqueousGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN
Ga0208898_110543423300025671AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRATKKEKPYFEDFPEMGIN
Ga0208898_111743813300025671AqueousMEIITILCFVSSMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFP
Ga0208162_100495553300025674AqueousMEILSVLCLSITFCYIGYIFGSSMKQIEASEKLITEAFKEGYIKGYFDGHDNATKKEKPYFEDFPSMRIN
Ga0208162_107132823300025674AqueousMEIVGYISSIVTFTYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYADCWAAKETDKKYYDDFPPMGTN
Ga0208427_106084843300025771AqueousMEIITILCFVSSMTYVGWLLGIAQQIEASEKSITEAFKEGYIKGYFDGH
Ga0208785_114801123300025815AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMG
Ga0208542_107800933300025818AqueousMEIVSVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFED
Ga0208542_117923913300025818AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGTN
Ga0208547_106829913300025828AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRATKKEKPYFED
Ga0208547_107170713300025828AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGI
Ga0208645_105314323300025853AqueousMEIIAVLSLSITTGYIGFIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHARAAKKEKPYYEDFPEMGIN
Ga0208645_106889443300025853AqueousMTIISVLSLSITFGYIGYIFGSSMKQIEASEKSTTEAFKEGYIKGYFDGHANATKKEKPYFEDFPEMGIN
Ga0208645_116421423300025853AqueousMGIVSVLSLSIMFCYIGYIFGSSMKQIEASEKSITEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMG
Ga0208644_125758233300025889AqueousMEIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHA
Ga0209953_100598523300026097Pond WaterMEIVAYISSIATFSYIAYVFGASSIKIEASEVSRSEAFKEGYIKGYTDCWAAKESDKKYYDEFPPMGTN
Ga0209953_104517733300026097Pond WaterIFGSSMKQVETSERSITEAFKEGYIKGYTDCWAAKESDKKYYDEFPPMGTN
Ga0209536_10066276543300027917Marine SedimentMEIITILCFVSSMTYVGWLLGIAQQIEASEKSTTEAFKEGYIKGYFDGHAHATKKEKPYFEDFPEMGIN
Ga0209536_10098902943300027917Marine SedimentMEIVGYISSIVTFSYIAYVFGASSIKIEASELSKSEAFKEGYIKGYADCWAAKEVDKKYYDDFPPMGTN
Ga0183755_102333023300029448MarineMIMTIVAYLASISTFTYIGYIFGASMRNIEASEKSTTKAFKEGYIKGYFDGHARAAKKEKPYYEDFPEMGIN
Ga0348335_046057_1572_17303300034374AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGHANAT
Ga0348335_060554_1232_13903300034374AqueousMEIITILCFVSSMTYIGWLLGIAQQIEASEKSTTEAFKEGYIKGYFDGHANAT
Ga0348336_091851_895_10563300034375AqueousMGIVSILFFSASMTYIGWMFGIAQQIEASEKSTTEAFKEGYIKGYFDGRATKKE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.